CAZyme Information: MGYG000000117_00154

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_00154
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		90623.02	5.3384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 158464; End: 160917 Strand: -

Full Sequence      

MKKTLLFSIILFCFFCNAYSADIIKVVSPRYCSEIQGNTKIDILAPNFEQIMVHCWKQGT
GLGTNSVVGTVKLDDKGTGSFVFPANEYPHGPITLRISGSSASNTDNCYLQLYNKSGVSW
KEGLPATPSPAQGMTLVYADDFDSALSIGGDGSNATYYDHKPPRGEEDFSSIPFVDFNSS
KNPFSQIDSYLRIRIDANKNSTGLISSIFSDKTGFSTMMPCYFECRFIGPNAPGTWPAFW
LMSVKDDINNYREPNDELDIIEAYGGEGKDSPNSGPLYSIAAHAWNQPGAPQQICDAFHA
SYFPTDMNKYGIPSTWYESPHIYGCKITETETIYYCDNIEVARHETLPISKTKPLYFMIN
LATGGGWPVDLSRYNNVADMYVDYVRVYSSNPRSIAVKEEVAVPANDFLNSIGANSAIYG
RGENIDKTVECCKYTGIRWIRLDNADKPASIAEFYKKSGVKVACCLGSLNTKKNFNLPAF
ISNVKKVAQSQALLAIEGCNEPNNWDVKYKGKKGGANASWLPVAELHRDLYTAVKKDEIL
KDYPVWSTTETGAQTDNCGLQYLTIPAGANTLMPDGTQYADVACCHNYFVHPGFPPVQNN
QTWVASDPTSACKVDGLYGNFGKTWIKNFTGYTEDELRSLPRVTTETGSTINGEVTEEMQ
ALLYMSTYLAQYKRGWSHTAMYILRDRTDENPELTYGFYGPDYTPRLAADYLHNFTTILA
DNKSIDSPGSLSYGIADQPETVHDLLLQKSNGNFSLVIWGERFKEGADNIRVNFGEVLKK
ATIYNPVVGTKPVKVVSGISAINLNMTNHPYIIEIEK

Enzyme Prediction     

No EC number prediction in MGYG000000117_00154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	140	388	1.2e-37	0.995575221238938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	8.01e-22	180	388	36	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	6.48e-20	140	388	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02177	GH16_kappa_carrageenase	1.10e-08	222	388	94	268	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
COG2273	BglS	2.94e-08	131	403	12	278	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02178	GH16_beta_agarase	3.89e-08	222	388	100	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVL33586.1	3.27e-149	24	389	217	587
QEH37426.1	1.05e-146	24	388	205	574
QUE50368.1	1.04e-104	24	388	161	519
AHF11964.1	5.13e-96	24	391	52	423
QGT72065.1	6.88e-89	22	390	44	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VY0_A	8.94e-10	187	389	68	260	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
5OCR_A	1.16e-08	177	391	55	286	Crystalstructure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_B Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_C Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_D Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans]
5DXD_A	3.80e-08	125	388	15	257	Crystalstructure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus [Mycobacteroides abscessus ATCC 19977],5DXD_B Crystal structure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus [Mycobacteroides abscessus ATCC 19977]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9Z3Q2	1.71e-15	56	389	142	458	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2
O33680	2.50e-11	165	389	257	458	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999027	0.000251	0.000156	0.000138	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000117_00154.