CAZyme Information: MGYG000000117_00863

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_00863
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37508.23	8.9521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 411860; End: 412828 Strand: +

Full Sequence      

MKIKAIYIVSGCILFIGSILFTSFRSAPGVVQPYRETPSFSVPEFPSHISFAGEDVDLER
FDMYERYDRELTSLCYGHTNTLLILKRANRYFPIIEPILKKQGIPEDFLYLVAVESLLNI
RALSPVKAAGLWQLMSKTGQQYGLEVNDYVDERYNIEMATIAACKYLKDAYNKYGSWLTV
AASYNAGMGRISSELSKQMVDHTFDLWLNEETSRYVFRILGIKEILSRPAEYGFTLRKKQ
LYQPIRTRKLEIDTAITDLAQFAKEQGITYSQLKEFNLWLRGRELPNKTGKKYIIQIPIE
QDMYYNGRREYVVYRKNWITEQ

Enzyme Prediction     

No EC number prediction in MGYG000000117_00863.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	91	224	7.1e-21	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	2.78e-58	99	224	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.36e-25	1	295	1	309	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	5.14e-23	94	191	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	3.01e-17	91	220	6	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.51e-15	111	221	7	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62457.1	1.24e-140	42	321	45	323
AHF11673.1	2.44e-133	42	322	3	282
QGT73861.1	3.10e-115	33	321	43	326
QNL36780.1	3.10e-115	33	321	43	326
QUT82863.1	5.44e-115	33	321	39	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.66e-22	50	295	61	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.66e-22	50	295	61	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.879630	0.118388	0.001414	0.000169	0.000121	0.000290

TMHMM  Annotations     

start	end
5	24