CAZyme Information: MGYG000000117_01514

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_01514
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		34708.51	5.9015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 254943; End: 255842 Strand: +

Full Sequence      

MREDMHFQLRSNYFLRLSLMVILLLCSFISYARTASQGQMSYHKIPTSILPGVTERDYTV
YLPKSYATQLDRRYPVLYLLHGGAGGAFSDWMERARLEGFANEIIDSGNACEMIIVCPDG
RYRDNAMWFNMEDWPAEDHFFQELIPYVDSTYRTLNDKKHRAVAGLSMGGGGSLFYAISH
PDMFSAVYAVSSYVEPLDRISAPRPDWSQTEVEKNNIIRLFDSATPEQVAKWKKLNWFID
CGDDDFTYDSNIRMIAAMRKQQIPYQLRIRDGGHTWQYWMTSLYLMLPFVSQSFVTEEK

Enzyme Prediction     

No EC number prediction in MGYG000000117_01514.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	54	291	3.8e-56	0.960352422907489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	4.95e-16	47	298	26	316	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	1.72e-15	40	288	72	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	7.38e-15	54	289	4	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	3.07e-09	36	263	1	220	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG3509	LpqC	7.56e-05	19	205	10	190	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE54274.1	3.46e-30	42	276	138	354
QMW04372.1	1.52e-28	43	290	136	379
AKD58571.1	1.52e-28	60	288	158	377
QUT65236.1	1.95e-28	55	288	161	394
QQA30430.1	2.70e-28	55	288	161	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.21e-66	54	297	24	275	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	2.61e-25	55	290	145	384	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	2.06e-22	60	298	50	265	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	5.47e-22	60	298	50	265	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZO_A	2.91e-17	60	292	135	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.64e-20	60	298	69	284	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	6.13e-14	54	288	443	666	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P9WM38	3.23e-11	33	277	167	428	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	3.23e-11	33	277	167	428	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
D5EY13	5.87e-09	60	184	518	646	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.446952	0.540652	0.010378	0.000940	0.000478	0.000583

TMHMM  Annotations     

start	end
13	35