CAZyme Information: MGYG000000117_02199

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_02199
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273		31243	8.7815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 160894; End: 161715 Strand: +

Full Sequence      

MKQKLSVFLLFLLWAMPLFAAVQVDTVVVRASRMNREVKNVVILPADYNESALYPVIYLL
HGYGGDYSSWLKIKPDLPQLATEKQVIFVCPDGLSSWYWDSPVNKDMQFETYVSKDLVGY
MDAHYRTVADRSGRAIAGLSMGGHGALWLSIRHRDTFGAAGSMSGGVDIRPFPEKWKMSV
QLGEKNKNPEVWEKHTVINLVPTLKNGDLAMIIDCGYDDFFFKVNNNMHNELLNRGIMHD
FIVRPGGHTSKYWNNSIDYQIVFFKKYFENARK

Enzyme Prediction     

No EC number prediction in MGYG000000117_02199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	259	1.7e-51	0.947136563876652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	6.23e-34	34	258	50	302	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	3.50e-31	32	253	2	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	9.16e-23	32	253	76	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0596	MhpC	1.40e-06	55	172	22	128	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
COG4099	COG4099	1.50e-05	26	195	162	322	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR22371.1	3.86e-22	24	257	44	269
QNL47921.1	4.00e-22	24	257	44	269
QEK50415.1	4.92e-22	23	257	42	268
AMV35885.1	3.46e-21	23	257	57	280
ADQ18000.1	3.57e-21	9	257	5	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.92e-22	42	264	30	267	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
4ROT_A	1.56e-18	55	258	47	251	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
4RGY_A	1.55e-17	46	257	35	254	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7B5V_A	5.29e-14	45	258	160	378	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	1.77e-13	45	253	153	373	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WM38	2.53e-16	42	249	192	426	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	2.53e-16	42	249	192	426	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
P23553	2.46e-14	57	257	44	254	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P0C1D6	3.41e-12	31	220	113	316	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1
P0C1D7	3.41e-12	31	220	113	316	Protein PS1 OS=Corynebacterium melassecola OX=41643 GN=csp1 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001070	0.998135	0.000230	0.000190	0.000170	0.000176

TMHMM  Annotations     

start	end
7	29