CAZyme Information: MGYG000000117_02482

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_02482
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000000117_9|CGC1	84810.03	4.9519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 131098; End: 133383 Strand: +

Full Sequence      

MKKLSLKTGVLSLLALGCSMSVSAQASENDGTYQMTGGDWQLSVNRATGTTDISKNQVIL
LNQTQPSFKSGSTIYSGSQLTVKNIEESDLNDKFGTGKQLQITSVTENESVTLVQHFYLY
NERDYILTEFTIESAEELESNYMAPIVASGSSVFLETSGNRALFVPYDNDQWVRYKSENF
GNTVTSYEVGALYNPDSRKGLVVGSVEHTMWKTGIVYTTTENAMTRLEVYGGITSSETRD
NKEHGAVKGTKIKSPLVFIGYYNDWREGMETYADANAIVAPKLPWDQGVPFGWNSWGAIQ
TNLSKKNATEVADYFKDTLVPGGFSNDGTVYIGLDSYWDNITYTDLRSFARSCKTKGLKA
GIYWTPFVDWAKDPNRTVEGSDNVKYKDIYLYANGQPQTIAGAYAIDPTHPATKTRAETY
LKRFIDQGFEYIKLDFMTHGSLECDGHYDKTVYTGIQAYNQGLQHIIDFLDGKMYINLSI
APLFPANYAHSRRIACDAYKKMSETEYTLNSLTYGWWLDRVYSYNDADNMCFYGATVGEN
RARMTSGLVCGMFTVGDDFSSSGAAKAKELAETCLLNKEVIKLARNGRSFRPVEGAAGDA
AADMFIQRVADTVYVAAFNYSIKVTQPLIDFDRLGLNKGTKYVVHEIWRDDISQKSDSWE
ESVPRYDVKLFKIYPGDLGSVDKTETGSGFLCYPNPCTDWLYVSNDGFEANYTILNASGQ
VVKEMSDSTGILSVADLEKGIYFLMSKTAEGKVNTATFIKR

Enzyme Prediction     

No EC number prediction in MGYG000000117_02482.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.40e-14	290	558	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	1.41e-09	290	581	2	266	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam18962	Por_Secre_tail	8.74e-08	693	744	2	57	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	4.77e-06	693	761	2	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
PLN02692	PLN02692	1.08e-05	290	435	57	177	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK83137.1	7.21e-207	4	673	6	673
QQY38591.1	1.02e-206	4	673	6	673
ABR38452.1	1.02e-206	4	673	6	673
QJR78498.1	1.44e-206	4	673	6	673
AII66839.1	2.89e-206	4	673	6	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000644	0.635569	0.362833	0.000365	0.000318	0.000246

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000117_02482.