CAZyme Information: MGYG000000117_02485

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_02485
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	MGYG000000117_9|CGC1	75625.32	6.8181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 137045; End: 139045 Strand: +

Full Sequence      

MKKYFISAFLFLLISAFSVKGENNRTSLHRGNWTISYDTKSGKADFLYKDKCVLADVAAV
AYTRNKYSSDAYERCEITEDKLNDDFGSGIKYTVVHMGEKKPVMKRIFFLYDNTDYFLTE
LVLESDVRIASNYMSPISTEKPVDILKKGDNRVLVVPFDNDKWIRYKSSPLNSGINSYEV
TALYNPDNREGLVVGSVEHDTWKTGIRVEADSKTRLSRLVCYAGAAGETTRDILPHGKVS
GTTVKSPKILCGFFKDWRDGMETFGKACAVVAPPREWSKGVPFGWNSWGKMQFNMTYDKV
LEVSDFFATDLQPKGFGNDSILYIGMDSGWNHMTDEQLAEIVKHCKQNGQRAGIYYTPFT
DWGRKPDKELEGAPGYTYKDVYLYANGKPQELDGAWAIDPTHPAVQQQIKYFADKFKKAG
FEYLKIDFLTHGAMESDSYYDRSVTTGIQAYNKGMSYLESQLEDFYITASISPLFPSQYT
HSRRIACDAFGNMSDAEYTLNSVSYGWWLDEVYTFNDPDHLVLEGASEGENRARVTSGVI
TGIYMSGDDFSKSGSSEAKKKALKFLTNRDINQLVRNGRTFRPVNGNDENTDCLFMLRSG
KDLYVAAFNYSGYDTTIELPLERLGLNRSEKYPCKELWSGKKTTEKGLFKIKLPRKDAAL
YRFELE

Enzyme Prediction     

No EC number prediction in MGYG000000117_02485.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.61e-14	282	549	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	2.12e-08	599	663	12	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	2.72e-07	273	523	283	567	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	1.58e-05	282	573	2	270	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65845.1	2.55e-252	10	664	11	674
QJR78498.1	3.61e-252	10	664	11	674
QJR69930.1	1.03e-251	10	664	11	674
QJR74262.1	1.03e-251	10	664	11	674
QJR65668.1	1.03e-251	10	664	11	674

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000679	0.874702	0.123864	0.000248	0.000246	0.000221

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000117_02485.