CAZyme Information: MGYG000000117_02492

Basic Information

• Species: Barnesiella sp003150885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp003150885
• CAZyme ID: MGYG000000117_02492
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	MGYG000000117_9|CGC1	99104.99	6.8029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000117	3354558	Isolate	Canada	North America

• Gene Location: Start: 151285; End: 153861 Strand: +

Full Sequence      

MKKIMITILCMFLFLLHAGIMKAEVSSRALSAGWTFRQARSEFWYPAAVPGCVHTDLMAN
RIIEDPFFRLNERGVQWVDKEDWFYQTYFDITDEEQNAVNQILVFKGLDTYADVYLNGKP
LLNANNMFREWRCDVKGLLKDKQNHLEVYFHSPVKIDVPKWESLPYQYSTGPDQAENGGL
FDKRISIWARKAGYHYGWDWGPRLVTSGIWRPVFLEVWNTARIDNVQLIQKNVTAKKAEL
STVVEILSDGNIENARVILTADGKEYAVKNIKLKPGINTVCLDYVIPCPRLWWCNGLGEP
YLYKFCTTVEIEGQKADAKLENIGLRSLKLISEKDKYGKSLYFELNGHKVFMKGANLVPC
DNFLPRVTDSIYEKTVADARDVNMNMLRVWGGGIYEDDAFYKYCDKYGILVWQDFMFACS
TYPADSAFLENVRQEAVYNVKRLRNHPCIAVWCGNNECQDIWFGWGGKKKMYEEQGYADI
IWEQFHNLFFGVLPEVVKQYAGGISYRPSSPFAFDDTPSDGINGDDHYWGVWHGREPIGN
YNVKRARFFSEYGFQSFPEYESVKIYAPDKRDQYITSEVMMAHQRAGNYANKLIEEYIEK
EYRKPADFESFLYVGMILQGDAIKTAIEAHRRDMPYCMGSLFWQHNDCWPVASWSSRDYY
GRWKAQHYFAKNAFADILVSPLVADDTVTVHVVSDRLKNEKGTFRLKVMDLKGTQIFEQV
SRLTVPANTSEKVFTGSLKKMIGNEQPGDVLLYVEFRTKDKLYRNIGYAVKQKDMNYPKA
HISSSVKKVDGGYEITLTSDNFARGVFMSIDGIRNFFEDNYFDILPGESRMVKVNTALTE
KEFKEQLKIVSLGDYYGG

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	803	3.4e-110	0.7646276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.08e-113	28	830	13	780	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.53e-22	779	854	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	6.44e-18	686	774	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	2.26e-08	30	457	15	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	6.33e-08	85	457	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60279.1	0.0	15	856	18	865
QUT88714.1	0.0	15	856	18	865
QGT72566.1	0.0	19	856	26	867
QUT31677.1	0.0	19	856	15	856
QRM99606.1	0.0	19	856	26	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.34e-230	30	856	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.49e-230	30	856	13	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.57e-230	30	856	13	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	6.82e-230	30	856	11	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	2.98e-228	30	856	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	4.28e-130	23	834	2	826	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	2.08e-126	30	834	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	8.00e-126	30	834	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
B8NW36	3.00e-125	23	834	2	827	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1D911	3.08e-125	30	834	9	828	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000414	0.998940	0.000215	0.000163	0.000145	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000117_02492.