CAZyme Information: MGYG000000119_01270

Basic Information

• Species: Blautia sp000432195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp000432195
• CAZyme ID: MGYG000000119_01270
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000000119_6|CGC1	34872.96	8.936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000119	3510293	Isolate	Canada	North America

• Gene Location: Start: 48809; End: 49723 Strand: +

Full Sequence      

MTVTVIIPTYKPDGKFRKLVKELKNQTYPIEKILILNTEACYWKDALIEGIQQAEVHHIT
KEEFDHGRTRAMGAAMADTDLLVFFTQDAAPANNKVIECLVKPFADDSIGGAYGRQLPSE
DCKFIERYTRSFNYPARSRVKRREDLPELGIKTYFCSNVCAAYRRSAYEKEGGFVTKTIF
NEDMILAAHMIQDGYGIAYAADAQVVHSHNYNYIQQFQRNFDLAVSQTDHPEIFAGVSSE
SEGIRLVKQTASYLLKQKKPWLIPDLILASGFKFLGYKAGQHYRRIPRWLVEKLTMNRAY
WKQG

Enzyme Prediction     

No EC number prediction in MGYG000000119_01270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	170	2.8e-16	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.05e-15	2	219	55	279	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	7.32e-11	5	179	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	1.24e-10	4	168	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	2.70e-10	1	207	3	219	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06434	GT2_HAS	2.03e-09	2	205	1	210	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99516.1	5.87e-151	1	303	1	303
QJU13078.1	9.12e-149	2	301	5	304
ANU76706.1	1.50e-147	2	301	5	304
QQQ94283.1	1.50e-147	2	301	5	304
ASU29511.1	1.50e-147	2	301	5	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	1.77e-65	1	301	1	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000119_01270.