CAZyme Information: MGYG000000122_00474

Basic Information

• Species: Staphylococcus epidermidis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus epidermidis
• CAZyme ID: MGYG000000122_00474
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266	MGYG000000122_2|CGC3	28228.92	6.4889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000122	2560588	Isolate	Canada	North America

• Gene Location: Start: 149519; End: 150319 Strand: -

Full Sequence      

MKKLAFAITAASGAAAVLSHHDAEASTQHKVQSGESLWTIAQQYNTSVESIKQNNNLSNN
MVFPGQVINVGGSASQNTSSNTSSSSASSHTVVAGESLNIIANKYGVSVDALMQANHLNG
YLIMPNQILTIPNGGSGSGSGGTATQTSGNYTSPSFNHQNLYTEGQCTWYVFDKRSQAGK
PISTYWSDAKYWASNAANDGYQVDNTPSVGAIMQSTPGPYGHVAYVERINGDGSILISEM
NYANGPYNMNYRTIPASEVSSYAFIH

Enzyme Prediction     

No EC number prediction in MGYG000000122_00474.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	5.60e-44	151	266	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK08581	PRK08581	1.82e-23	162	265	508	616	amidase domain-containing protein.
pfam05257	CHAP	8.43e-19	160	241	3	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
pfam01476	LysM	8.89e-13	29	70	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	3.93e-12	29	70	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRI95856.1	2.10e-178	1	266	1	266
QRJ25994.1	2.10e-178	1	266	1	266
QRJ16722.1	2.10e-178	1	266	1	266
QRL23248.1	2.10e-178	1	266	1	266
QRJ26704.1	2.10e-178	1	266	1	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	3.18e-39	153	266	43	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	3.56e-39	155	266	3	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	1.20e-16	162	265	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	9.63e-06	89	132	4	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	1.15e-146	1	266	1	265	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q5HRU2	2.53e-71	27	266	84	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	2.53e-71	27	266	84	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q6GJK9	3.46e-68	29	266	93	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q4L3C1	4.24e-68	2	266	3	329	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000386	0.998837	0.000180	0.000219	0.000189	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000122_00474.