CAZyme Information: MGYG000000123_00704

Basic Information

• Species: Blautia sp001304935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp001304935
• CAZyme ID: MGYG000000123_00704
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
730		82868.27	5.2897

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000123	5803260	Isolate	Canada	North America

• Gene Location: Start: 156148; End: 158340 Strand: -

Full Sequence      

MAIKKDTTGKLFTLLTNNSMYQMKVDDLGFLVHTWFGKRTPIFDYSYLNVGRDRGFSGNP
YIAGDNRAYSLDTLPQEFPTYGNGDYRESAVRIRYASGASSCEFRYESAQILEGKYSLPG
LPAFYALKEDTADTLVITLKDSTQNVYVHLYYGVLEEKDIITRSVTVENKGESPIYLERI
MSTCTDFQFGDFDFISFYGRHAMERLLSRTQVHHGIQSVGSTRGSSSHHYNPFVMLAAQG
TTETRGECYGFSFLYSGDFLAEAEKDQSGQTRFLMGIHPDNFCYKLDSGEAFHAPEAAMV
YSAEGMEAVSHRFHRAIRNNLCRGEYKKARRPVLINNWEGTYFDFTGDKLVEMAEQAKDM
GVELFVMDDGWFGKRESDNSGLGDWIVNEKKLGCTLKDLSARIHALGLKFGIWFEPECIS
EDSDLYRAHPDWAFKVPEKSPVRSRYQLVLDFSRKEVRDHIYNMMCNVLDNAQVEYLKWD
FNRSIGDIFTIALPADRQGETAHKYILGLYEFLENLNKRYPGMLIEGCSGGGGRFDAGML
YYTPQIWTSDDTDSIERLKIQYGTSFCYPVSTMGAHVSASPNHQTGRAASLSTRATVAMA
GTFGYELDPAKLTEEEKAEVRTQIETFKKYYSLIQDGTYYRLASPYENEEYTVWEFAAED
KSEALLGIVSTKLTANNLFTCIRLRGLDPNAMYRMGDKTYLGAALMEAGLPMPVPETEYQ
SWNLHLVKES

Enzyme Prediction     

No EC number prediction in MGYG000000123_00704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	12	711	3.1e-267	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	11	710	3	665	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.0	292	637	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	8.22e-143	330	629	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	2.17e-118	29	287	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	2.51e-21	651	726	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU16478.1	0.0	1	730	1	730
ASU30552.1	0.0	1	730	1	730
ANU77746.1	0.0	1	730	1	730
QQQ95349.1	0.0	1	730	1	730
QBE96096.1	0.0	1	730	1	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	6.00e-290	1	723	1	714	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	3.17e-231	1	729	1	729	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	1.03e-229	1	729	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	9.45e-228	1	729	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNP_A	9.45e-228	1	729	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	5.47e-286	1	723	1	714	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	5.63e-229	1	729	1	729	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	2.49e-212	3	725	6	727	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	4.28e-208	3	725	4	726	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q5AU92	2.79e-176	74	729	95	750	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000123_00704.