CAZyme Information: MGYG000000123_03383

Basic Information

• Species: Blautia sp001304935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp001304935
• CAZyme ID: MGYG000000123_03383
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000000123_10|CGC2	57167.67	4.9574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000123	5803260	Isolate	Canada	North America

• Gene Location: Start: 188421; End: 189884 Strand: -

Full Sequence      

MNVMRDTLLREIRRMETEYQNRPGPDKWRLRFHIMPPAGWLNDPNGLCFYRGKYHFFFQY
SPFDPEGGLKVWGEYTGTDLVHWQYEGTPLLPDSPWDCHGVYSGCAFTEDGLLDIFYTGN
VKLDGDYDYVNSGREANTIYTCSEDGIHFREKECLLEMKDYPTGYTNHIRDPKVWKAGDT
CYMVLGGRKKDNRGAVLLYASKDKKHWEFVREVTTREPFGYMWECPDAFCLDGQWLLSVS
PQGLKREEFCRQNIYQSGYFILPEKWMEEGEPKEFREWDMGFDFYAPQTFTDEKGRRILV
GWAGLPDIKEEYNNPTVEQGWQHAFTMPRELKWKNGKVYQYPVKEAEMLREKELFSGSRQ
DRDPEKTQGILVEDSCFDWEIKETDSRSFIIIIEEECVLKYEDGVFFLSFEGAMGAGRKV
RKALVPKLYSIRILADTSLMEIYLNEGEYVFTSRYYTESDVRQLSVRGLQNAGNIWTMKK
QTCLTGL

Enzyme Prediction     

No EC number prediction in MGYG000000123_03383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	342	6e-91	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	6.24e-157	39	335	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.52e-146	18	457	3	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	6.00e-135	25	481	25	483	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.66e-112	33	447	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	7.95e-112	33	342	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX26047.1	5.55e-215	1	480	1	469
QNM06260.1	6.43e-194	1	478	1	478
CBL20909.1	7.84e-185	1	479	1	470
QCU01937.1	3.65e-183	1	479	1	470
ADZ81804.1	1.77e-170	1	478	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	6.37e-73	32	464	29	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
3PIG_A	4.17e-66	26	466	37	495	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
7BWB_A	4.76e-66	6	460	27	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.02e-65	6	460	27	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	3.16e-60	26	466	37	495	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	5.09e-105	11	478	7	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P40714	6.09e-86	32	466	28	459	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P13394	4.08e-85	26	472	34	468	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P37075	5.40e-84	20	484	18	464	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	1.80e-81	31	456	29	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000123_03383.