CAZyme Information: MGYG000000123_04121

Basic Information

• Species: Blautia sp001304935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp001304935
• CAZyme ID: MGYG000000123_04121
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	MGYG000000123_14|CGC4	90433.13	4.958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000123	5803260	Isolate	Canada	North America

• Gene Location: Start: 169263; End: 171629 Strand: -

Full Sequence      

MRFTDGLWESRNGYKLHRAHSLWEWRAEKNQVHFMVPCTEIRSLRDTIAGPVLHFTITAP
KADILAVKAYHFTGKKECGPYFDLDVSYRDMEVCEMEQEITVTNGRMKAVVRKTGDFGIA
FYFDGRFLTRCGEKGTAYVTDAEYEADKLCDYNGRNGRSSQNENYIREMLSLDVGEYIYG
LGERFTSCIRNGQSVDCWNRDGGSNGNQAYKNIPFYLSSKSYGVFVNTPARVGFEVANVS
VRHVEIAVQEEELEYMVIGGSEPKEVLSNYTALTGRTPVPPAWTYGLWLSTSWMPDSDAQ
ITLDTIDKMKEYDIPLSVFHFDARWMDDFKCCDFVWSKRFGDAKKLLDAIHERGVKVCVW
INPYISQESYLFREGKDNGYFLKTKDGDVWQSDNWMSGIAIVDFTNPEAVRWYQSKLGAL
LDMGVDALKTDFGERIPTNVVYFDGSDSAKMHNYYPYLYNQAVYELIQEKKGEGCVFSRS
ATAGTQKFPFNWGGDNEASYISMAESLRGGLSLCQSGYGYWAHDISGFCRTATPDLYKRW
VQFGLLSTHSRLHGEQSYRAPWYFDEESCRVLKAFTNLKCRLMPYLYSGSVQVLEEGIPL
MRAMMLEFPQCPTSLHLERQYMLGSDLLVAPIFNEEGQAEFFLPGNGCWTNYLDSEILEG
GKWYRRNYDYFHMPLFVRPGTILPVGAEEDTPVYDYADGVTFQLYEIPEAFEKDCRVYNT
SGEPVLKLNVKRMGENITLELQGQAEHVFVQLMHVNDIRCDGEVRREKCENGIRFEMREG
ILEFALQS

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	255	683	6.2e-127	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	42	787	33	764	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10658	PRK10658	0.0	1	680	1	665	putative alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	6.79e-176	275	582	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	6.48e-157	257	683	2	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	2.12e-70	156	662	62	603	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99526.1	0.0	1	787	1	787
QIB57882.1	0.0	1	787	1	787
QMW77312.1	0.0	1	787	1	787
AZT89866.1	3.42e-280	1	772	1	757
ACM61134.1	5.57e-280	1	737	1	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	5.63e-232	1	782	1	760	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	6.64e-232	1	782	1	760	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	7.10e-219	2	782	2	760	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	2.32e-108	176	689	202	721	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	5.45e-72	98	752	185	878	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	2.98e-231	1	782	1	760	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
P96793	2.57e-199	1	757	1	747	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q5AW25	1.29e-198	1	700	1	713	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
Q9F234	9.17e-72	90	706	83	708	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P0CD66	6.36e-53	161	689	47	614	Alpha-glucosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=malA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000123_04121.