CAZyme Information: MGYG000000124_00031

Basic Information

• Species: Citrobacter youngae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter youngae
• CAZyme ID: MGYG000000124_00031
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216		24141.16	8.7677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000124	5038075	Isolate	Canada	North America

• Gene Location: Start: 23460; End: 24110 Strand: -

Full Sequence      

MLLTQSQFQKAAGISVVVAARWLEPLCAAANEFQINTPKRLAAFIAQVGHESGGFNTISE
NLYYSDAERVARIFRSDFDLNKNRIIEPAEVEFARRYIRNPEKMANYVYANQGGNGNEAS
GDGWRYRGRGLIQITLRNNYRDCGKGLGLDLLNNPDLLLDFNQAARSAAWYWRTNGCNEL
ADSGSFLAITRRINPPAQGQADRQARYDVAKAVLCV

Enzyme Prediction     

No EC number prediction in MGYG000000124_00031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	31	200	1.6e-37	0.5584415584415584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	1.72e-62	1	214	2	204	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	3.47e-05	22	207	22	207	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	0.001	28	209	32	189	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT70772.1	1.58e-155	1	216	1	216
AYL54851.1	3.71e-154	1	216	1	216
ASG44429.1	4.34e-153	1	216	1	216
QNB20100.1	1.10e-125	1	214	1	214
AZL61686.1	1.57e-125	1	214	1	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	7.62e-47	6	214	19	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
4IJ4_A	2.93e-11	123	194	90	164	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	2.97e-11	123	194	91	165	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
7F88_A	4.97e-11	125	194	84	156	ChainA, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]
2DKV_A	6.38e-10	123	214	164	254	Crystalstructure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_A Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_B Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	1.24e-33	42	207	41	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	1.88e-12	38	213	215	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
P17514	9.75e-10	125	214	118	206	Acidic endochitinase Q OS=Nicotiana tabacum OX=4097 PE=1 SV=1
Q7DNA1	3.89e-09	123	214	195	285	Chitinase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht2 PE=1 SV=1
Q41596	4.96e-09	123	174	178	230	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999972	0.000067	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000124_00031.