CAZyme Information: MGYG000000124_00397

Basic Information

• Species: Citrobacter youngae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter youngae
• CAZyme ID: MGYG000000124_00397
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1337	MGYG000000124_1|CGC4	148454.22	6.0577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000124	5038075	Isolate	Canada	North America

• Gene Location: Start: 431743; End: 435756 Strand: +

Full Sequence      

MKKILALNFFPAFVPISNGGESKLYNFYKALSKYHHVTLLTSTHPGVKEEKIYHTATFVE
RRIPKDKYFDQCWQNLESYTSDGHGDLSAPAIAASAQYPTTMLAAYLSEYESADIIIHDF
PFTVDFDIFLGIDCKPRIYNSHNCETELYQTLHPSEKSQPIVDLVSKAEKKLLNNADLIL
YCGESDYESFKKIAPQKESVMFYSPNGMVDNHRAIPRRATKVKHSAVFVGSAHLPNVNAA
IYVAKEIAPKCPNIIFDIIGNCLPVGEYVKNVVRHGRVTDEEKVRLFENASIALNPMESG
SGSNIKALDYFAYALPILSTPFGMRGFNTESGKNVIEGAMEDFPDLLKQHLSDSDFANTV
EIGLAGKLFASENYTWDVIVANILPELDKLEKQSSNYTLVLNDYNSFSSVGGGGTRTRGI
YQAVNDISSVVFICFSDDEKLSVEKYNEKTYVICVPKSPEHRKQVDELNAQFHVSCDDII
ASVHCAKNDLLVAVYNILKLSARFIIIEHPYMAPVPITYRDRFIYSSHNDETILKKSLLE
WHPKKNYLIDIVTSVERNAVECSAATIAVSDGDAYSLLVGKKTAGPMIVVRNGAQLPSPI
TNDIRQQVTQRIAKKSAVFLGSAHMPNVDAANFLLKNIAPKCPDVQFNIVGSVCNSINVN
PGKNVILWGVVDEEVKSAILQNCLFAVNPVTSGSGSNIKLADFFANGLFVVSSKFGLRGY
PSHLHKHIAPTEPETFSDVINALSISDGVFTDEMRAERKDIFRAELSMVGIAKKFVDLLL
SMEKPKRKVLFVTYRYTHPELGGAESNLKRFLKALGDTQEFEIDVVTTEVSRTTNHARFM
ERYEFDAEIGAPIEMSNLRFARFPVDDSPSSALSNATSLAWRVQPVFEKAIVQQTDKLSL
DGLAWGWADLEGEVSSHYRWSYSSCAVNVAKASKVKLIGYIPEKSLITLQSPDGGIYLSQ
EIEHNFTLELEVDAGIFEIFTSSRFMGGQDPRPLGFMLTELLIDSAPLDLTRPTLASSQS
ISPDKVFDVLSTAAEKTRFPLGVNLTDIRGPHSSSMEHYIATNIGKYDLVVTHNIVFKPA
VFALDLAKQHNVPSLLIPHAHLDDDYYHFPDLIHAARNATKVLAVPKAANAFYVEKGCCS
EYLPAGADTDEEFLESDRHEFESVYGSDDEFVLVLGRKSGAKGYRSVIQAVESINQSGKK
LQLVMIGPDDDGLVITSPHVSYLGRQPRSVVRGALMSCLALVNMSSSESFGIVLLEAWLA
RKPVIVNKSCVAFHDMAVDQENALMVGHEELQDALVRLRNEPALCERLGSNGFETVQKFS
WQVVENDFVNICRKVVR

Enzyme Prediction     

No EC number prediction in MGYG000000124_00397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1168	1303	5e-17	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.90e-29	1060	1333	76	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	6.39e-24	1064	1337	81	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.81e-20	7	384	3	362	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03800	GT4_sucrose_synthase	6.19e-18	1056	1324	91	392	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
cd03798	GT4_WlbH-like	2.64e-15	1065	1327	94	368	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU66538.1	0.0	1	1337	1	1337
AWU66553.1	0.0	1	1337	6	1342
AWU66568.1	0.0	1	1337	1	1337
AWU66601.1	0.0	1	1337	1	1337
ANS42064.1	0.0	1	1336	1	1336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58577	4.37e-08	1162	1322	171	336	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
O07147	8.22e-07	1172	1335	191	363	Phosphatidyl-myo-inositol mannosyltransferase OS=Mycobacterium leprae (strain TN) OX=272631 GN=pimA PE=3 SV=1
Q9R9N0	1.67e-06	1169	1331	167	335	Lipopolysaccharide core biosynthesis glycosyltransferase LpsD OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000124_00397.