CAZyme Information: MGYG000000124_01935

Basic Information

• Species: Citrobacter youngae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter youngae
• CAZyme ID: MGYG000000124_01935
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000000124_2|CGC4	62464.51	9.3603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000124	5038075	Isolate	Canada	North America

• Gene Location: Start: 350365; End: 352023 Strand: +

Full Sequence      

MKPAARYTLACIAFIALYFILPINSRLLWQPDETRYAEISREMLTSGDWIVPHFLGLRYF
EKPIAGYWLNSIGQWLFGANNFGVRAGAIFATLLTALLVARLAMRLWQDKRTAILSSVIF
LTFFSVYSIGTYAVLDPIIALWLMAGMCCFWEGMQATTRTRKVVAFLLLGFTCGMGVMTK
GFLALAVPVLSVLPWIFMQKRWKDLIIYGLLAVVGCVVIVLPWGVAIAQREPDFWHYFFW
VEHIQRFAQDDAQHKAPIWYYIPVFVAGALPWLGLLPGALRTGWRERDVPRSAQYLLSWI
VMPILFFSIAKGKLPTYILSCFAPLAILTARFGLQAAEKGSAALRVNGWINVLFGVSGIV
ATIIVSTLGPLKTPVWSHIETYKVFCSWGIFITWTLFGWYTLNNREKNWKLAALCPLGLA
LLFGFSVPDRVMESKQPQFFVEMTKESLESSRYIFTDSVGVAAGLAWSLKRDDINMYGQT
GELKYGLNYPDAQGRFVSRDDFAGWLAQHRQEGIITLVLSISKDEDINQLAIPPADYIDN
QGRLVLIQYRPK

Enzyme Prediction     

No EC number prediction in MGYG000000124_01935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	527	1.1e-154	0.9703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	551	1	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.19e-112	12	525	14	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	5.49e-46	4	238	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	5.35e-10	62	223	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHD98093.1	0.0	1	552	1	552
AYL47603.1	0.0	1	552	1	552
AYY48176.1	0.0	1	552	1	552
QLV29919.1	0.0	1	552	1	552
QGJ54039.1	0.0	1	552	1	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.52e-36	4	427	30	452	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TBG8	6.23e-315	1	552	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
B5EZI0	9.33e-310	1	552	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella agona (strain SL483) OX=454166 GN=arnT PE=3 SV=1
B5BCP4	9.33e-310	1	552	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=arnT PE=3 SV=1
B7LM74	1.04e-309	4	552	3	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
B4TPI4	1.32e-309	1	552	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
82	100
113	135
176	198
205	227
258	280
293	310
315	334
347	369
384	403