CAZyme Information: MGYG000000124_03431

Basic Information

• Species: Citrobacter youngae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter youngae
• CAZyme ID: MGYG000000124_03431
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		29916.5	9.4695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000124	5038075	Isolate	Canada	North America

• Gene Location: Start: 279116; End: 279886 Strand: -

Full Sequence      

MYVLVISLPFDDARRKRVSDIMNELKIEYSFVDAIYGKNLSAEEKRKIPLTDFQHRENHT
PTDGELGCSLSHMKAFKQFGQSGQDWVCILEDDAIIDQNFKEFISTVDESVLNKDALYLL
GGQDGLRYKNKVVLNLLKLKKIGGQTFGKVIFGHGYVLRACGYLMNSVTAQKLVSRFENN
FFIIDEWAYLMRQGYFSDIYLANFVHHPEELSGSWLEKERKEIKSHKKKQKSLFRRKISS
SYWYGRRIILGLCWWK

Enzyme Prediction     

No EC number prediction in MGYG000000124_03431.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	3	185	1.2e-28	0.9613259668508287

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06532	Glyco_transf_25	1.09e-28	3	99	2	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
pfam01755	Glyco_transf_25	4.15e-25	3	186	4	198	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	6.94e-14	1	237	3	238	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMH12461.1	4.01e-187	1	256	1	256
AYL63511.1	4.01e-187	1	256	1	256
VEI39586.1	4.01e-187	1	256	1	256
BAT23489.1	4.59e-75	1	220	1	220
VTS49845.1	4.59e-75	1	220	1	220

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0JPH3	2.91e-10	3	119	332	456	Procollagen galactosyltransferase 1-A OS=Xenopus laevis OX=8355 GN=colgalt1-a PE=2 SV=1
Q5U309	9.29e-10	3	204	299	496	Probable inactive glycosyltransferase 25 family member 3 OS=Rattus norvegicus OX=10116 GN=Cercam PE=2 SV=2
A3KGW5	1.70e-09	3	204	319	516	Inactive glycosyltransferase 25 family member 3 OS=Mus musculus OX=10090 GN=Cercam PE=3 SV=1
Q5U483	5.62e-09	3	119	332	456	Procollagen galactosyltransferase 1-B OS=Xenopus laevis OX=8355 GN=colgalt1-b PE=2 SV=1
Q17FB8	1.36e-08	2	174	324	490	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000124_03431.