CAZyme Information: MGYG000000124_04542

Basic Information

• Species: Citrobacter youngae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter youngae
• CAZyme ID: MGYG000000124_04542
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000000124_9|CGC2	21086.47	9.6916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000124	5038075	Isolate	Canada	North America

• Gene Location: Start: 90341; End: 90898 Strand: +

Full Sequence      

MRSERILSCYLAMTLLILSFSPSPLMASSNSPPDTFDACFNSAGARYQIEPLLLKAMAKG
ESWLRPWVTNTNRDKKGNPVSTDYGLMQINSTHVPKLIRMGIIQSAEDLLKRPCLNIQIG
AWILARHFQVCGVTWNCLGSYNAGFRKDRHETREQYANRIWGFYLELKGLRVCRQEKGKR
ICEPS

Enzyme Prediction     

No EC number prediction in MGYG000000124_04542.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	46	167	1.2e-16	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	3.39e-44	47	164	1	107	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	4.60e-36	10	181	3	154	type III secretion system invasion protein IagB.
PRK13722	PRK13722	3.76e-21	39	177	22	158	lytic transglycosylase; Provisional
pfam01464	SLT	2.51e-18	40	149	1	100	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.37e-11	10	144	113	240	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZZ88399.1	3.27e-135	1	185	1	185
ALA08801.1	1.09e-133	1	185	1	185
QHM78097.1	4.61e-126	1	185	1	185
QRQ76978.1	1.69e-125	15	185	2	172
QFX91995.1	1.19e-120	26	185	1	160

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.26e-10	39	129	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X6H3	1.16e-43	38	170	27	159	Peptidoglycan-binding-like protein OS=Escherichia coli O157:H7 OX=83334 GN=pbl PE=3 SV=1
Q46790	6.06e-39	37	170	26	156	Putative peptidoglycan-binding-like protein OS=Escherichia coli (strain K12) OX=83333 GN=pbl PE=5 SV=2
E1WAC2	1.56e-28	39	181	21	154	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.56e-28	39	181	21	154	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	2.47e-27	39	181	21	154	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000324	0.998992	0.000196	0.000182	0.000150	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000124_04542.