CAZyme Information: MGYG000000125_00513

Basic Information

• Species: Clostridium_B tyrobutyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_B; Clostridium_B tyrobutyricum
• CAZyme ID: MGYG000000125_00513
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		32323.18	4.4536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000125	3256597	Isolate	Canada	North America

• Gene Location: Start: 36593; End: 37474 Strand: +

Full Sequence      

MNIYVVIGGDSIWSISQKFGVNPENIIRANALDPNESLVIGQTLVVSSTEGSYMVQPGDS
LWNIASRFGVSLESIISVNNISDPAQIYPGMMIIIPSQSKNYGYIETNAFIQPGSPERDR
NLVSGVARYLTYLTPFSHQVTEDGSLTPLNDDAAVNTGRNFRTAPLLSVTNISGDNFDSN
LIQNILNNENLQNNLIDNIVSELQAKSYSGVVIDFERIPPADREKYNDFLRKLVARLHPM
GYVVGTALAPKTYDITTGSWHGAHDYRAHGEIADFVIIMTYEWGWSGGTDQIN

Enzyme Prediction     

No EC number prediction in MGYG000000125_00513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	116	287	8.9e-16	0.38513513513513514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3858	YaaH	3.81e-86	1	289	1	289	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd02874	GH18_CFLE_spore_hydrolase	2.40e-68	105	289	2	185	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
smart00257	LysM	4.63e-14	53	95	2	44	Lysin motif.
pfam01476	LysM	1.67e-13	53	96	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.95e-13	52	95	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANP69094.1	6.58e-156	1	288	1	288
QNB66553.1	6.58e-156	1	288	1	288
AND84480.1	6.58e-156	1	288	1	288
APM38385.1	4.47e-104	1	288	1	288
EDK33046.1	1.27e-103	1	288	1	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	1.71e-44	1	288	3	291	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	8.15e-37	3	288	6	293	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	1.24e-25	107	287	10	189	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	2.99e-07	120	288	27	196	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9K3E4	1.73e-43	1	288	2	290	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P0DPJ9	3.37e-43	1	288	2	290	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
P37531	1.04e-39	1	291	1	292	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	7.90e-27	1	287	1	281	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000125_00513.