CAZyme Information: MGYG000000125_00590

Basic Information

• Species: Clostridium_B tyrobutyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_B; Clostridium_B tyrobutyricum
• CAZyme ID: MGYG000000125_00590
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000000125_2|CGC2	75627.96	10.3179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000125	3256597	Isolate	Canada	North America

• Gene Location: Start: 91719; End: 93788 Strand: +

Full Sequence      

MYNRIRLTKRHIPLIFILLLSAVLNFVNLGIEGYGNTFYAAGVKSMVMNLKNFFFASFDP
AGFVTIDKPPVGFWIQTISAKIFGFSGWSIILPQALAGVISVAVIYHIVKRSFGNTSGLI
AALCLAITPISVAAGRNNTIDNLLVLPMLLACWAALIAAERGKIKYLILSLVMVGIGFNI
KMVEAYMVAPAIYITYLLTSSMSFKKKMRDLIVGTLVLLVVSLSWAVIVDLVPASQRPYI
GSSTNNTVMQLIIGHNGLERIGIGGRNGQMNDNFRKRNSLDQENNFGGSGNSNLSVSFKR
ANRYGSGNNFRSGSNFENRANEAYSRNSQSGIFRLFGSGNMSDQISWILMLAIIGFIAAA
VKEKLKAPFNNRRKLSLILWVAWLMPEFIYFSFSKNITHTYYLTTMAPPIAALAGIGLFE
MWEFYKSDSNKSWILPTALILNGFIEIIILSHNGKSAGYRIIIILTAILCIVSSIVLCII
NLSKRYKNKIVISRTFAAVAFAGILVAPAVWSFTPMFYKMNGSSPSAGLELSRSNSRSSI
GMYNNESSGNNSKLISFLEKNYKEEKYDVAVPSATSYGSELILETGKSVMALGGFSGSDP
ILTLKQFKQLVNNGDVRYAIVNITSGRINSPNNNIVNWIRKSGTIVPESEWKDSTSSMQQ
TANQSSVSGFGISRGVNSTELYDLKSAHS

Enzyme Prediction     

No EC number prediction in MGYG000000125_00590.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	12	229	1.9e-33	0.39814814814814814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.84e-70	6	651	2	531	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	4.60e-41	67	225	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	7.89e-04	1	183	14	211	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02516	STT3	0.001	58	224	57	235	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG4745	COG4745	0.002	81	231	78	231	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB37647.1	2.43e-77	17	646	210	780
QHU89858.1	6.68e-76	32	646	293	889
QHU90800.1	8.03e-74	32	646	293	886
QLF52252.1	2.75e-71	32	646	293	891
QJU11362.1	2.75e-71	32	646	293	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.50e-06	67	230	87	255	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34575	3.77e-120	12	663	10	679	Putative mannosyltransferase YkcB OS=Bacillus subtilis (strain 168) OX=224308 GN=ykcB PE=3 SV=2
P37483	3.19e-116	8	657	3	662	Putative mannosyltransferase YycA OS=Bacillus subtilis (strain 168) OX=224308 GN=yycA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991005	0.000909	0.000195	0.000006	0.000004	0.007907

TMHMM  Annotations     

start	end
12	34
84	106
113	135
140	159
166	183
187	204
211	233
345	362
375	393
397	419
432	451
461	483
490	512