CAZyme Information: MGYG000000126_00682

Basic Information

• Species: BX12 sp902363595
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; BX12; BX12 sp902363595
• CAZyme ID: MGYG000000126_00682
• CAZy Family: CE14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000000126_2|CGC2	25686.85	7.3714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000126	4489456	Isolate	Canada	North America

• Gene Location: Start: 171233; End: 171916 Strand: +

Full Sequence      

MFKCKKILIIAAHPDDEILGCGGTIARAIKEGAQVHSLVLGEGKSSRDAISVDQIKREQK
ELRKEGLKANQCLGIESVHFLDFPDNKFDEVPLLNFTKIIEKKVEEIQPDTILTHYAQDL
NIDHQITYKAVITATRPIKKQIVKKIFSFEVLSSTEWNYPTTFSPNLFVDISDTIDIKLE
ALGYYASEMREYPHPRSIKAVDLNAKMWGVKCGLYKAEPLLLVRGLI

Enzyme Prediction     

No EC number prediction in MGYG000000126_00682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	8	118	6.8e-22	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	1.37e-36	5	195	11	201	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	2.31e-33	9	132	1	125	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.
TIGR04001	thiol_BshB1	7.70e-20	7	222	4	220	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
PRK02122	PRK02122	6.29e-05	5	140	370	555	glucosamine-6-phosphate deaminase-like protein; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV67908.1	2.44e-47	7	226	343	567
ATZ07896.1	2.08e-17	8	225	9	221
AGN01300.1	1.81e-16	7	189	3	182
ACM04726.1	4.93e-16	6	191	11	200
AKL73227.1	5.26e-16	5	191	9	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAN_A	2.18e-15	7	219	4	212	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]
2IXD_A	2.34e-09	7	218	6	215	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
3WE7_A	2.91e-09	5	226	36	261	CrystalStructure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_B Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WE7_C Crystal Structure of Diacetylchitobiose Deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3WL3_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5B2E_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2E_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (acetate-containing condition) [Pyrococcus horikoshii OT3],5B2F_A N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_B N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3],5B2F_C N,N'-diacetylchitobiose deacetylase from Pyrococcus horikoshii complexed with its inhibitor MPG (phosphate-containing condition) [Pyrococcus horikoshii OT3]
6P2T_A	1.03e-07	7	218	26	237	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
4XM1_A	2.72e-07	5	191	32	221	N,N'-diacetylchitobiosedeacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_B N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_C N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_D N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_E N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_F N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_A N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_B N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_C N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_D N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_E N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_F N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81AU5	1.83e-11	5	208	3	208	Probable N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB2 PE=1 SV=1
Q6F4N1	1.48e-10	5	191	32	221	Diacetylchitobiose deacetylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=dac PE=1 SV=1
P71311	5.16e-10	3	187	15	185	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1
Q81FP2	1.19e-08	7	218	6	215	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB1 PE=1 SV=1
Q81ST8	1.04e-07	7	218	6	215	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999901	0.000136	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000126_00682.