CAZyme Information: MGYG000000127_01944

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_01944
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000000127_3|CGC6	33624.14	4.5092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 348073; End: 348984 Strand: -

Full Sequence      

MIMKKLLLSLILFAGTFIVCIGGITVAKGYNYYKDALNEKSLTEMAAEIRSNENYTDIDQ
MPQIYKNAVIAVEDKRFYNHSGIDLIAIGRAVYHDIKAGSFVEGGSTITQQLAKNQYFSQ
DKDITRKIAEVFMAIDMEKRFTKDEILELYLNSIYFGDGYYCVADAANGYFGKSPNEMTD
DEATLLAGVPNAPSVYAPTVNPELARQRQKQVVAQMIDCGFLDDVTVAQALETFQQNSSA
NEITPVNYKEDALTQTPKSSGLLDSYVTACREYAASALDYRQPVSYLLRLLPDLGSQLMA
SGN

Enzyme Prediction     

No EC number prediction in MGYG000000127_01944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	216	2e-64	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.10e-84	52	216	12	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.08e-81	55	238	4	187	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.06e-72	55	251	78	276	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.32e-72	3	230	1	241	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	7.75e-48	58	248	71	252	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP41835.1	8.62e-94	18	239	18	236
ASN93505.1	8.62e-94	18	239	18	236
QJU22158.1	2.00e-92	18	239	18	236
QIX92252.1	4.01e-92	18	239	18	236
ANU46909.1	4.01e-92	18	239	18	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	7.35e-47	55	222	22	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.91e-46	55	222	22	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	2.85e-38	37	231	41	241	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.12e-38	48	231	16	205	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	4.24e-38	48	231	17	206	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.07e-47	4	222	7	236	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87626	1.18e-45	55	278	70	305	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q07259	1.10e-44	50	220	44	213	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87579	2.48e-43	55	289	70	306	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z5	4.63e-43	55	218	70	233	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.646674	0.202265	0.139191	0.001314	0.000812	0.009739

TMHMM  Annotations     

start	end
7	26