CAZyme Information: MGYG000000127_02028

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_02028
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000000127_3|CGC7	95590.28	5.777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 431603; End: 434020 Strand: +

Full Sequence      

MGRLFLKENQLADYELVVQKTATDNFYTDIVIYFVLEGRMSIQINGQEYALAQRDFIAVN
PCCYHSWQIEAHSLIAFFMINVHELEKYYNLEKIWFNCYSKIEPMEFHTSFRALLDACIG
KYYGKKAADGRTMLRLNGIYFQLVDALITNYSVPVKHKEREDAVSEDEGRINRILNYIHM
NFRQTITLASLADQFFMSTAYLSRYFKKETGKNFGEYLTEVRLDFAVLELESTDKSIVRI
ALDNGFANVSSFNKAFKEKYQMAPKKYQEQHMLKTRSVKEELDAAALEHRLKDYYESGQS
EEKCSHYEKPLIVDACDYKIIAPSWNKMINIGRISSLLRSDIQEHTLILKRELNIQYIRM
WDLYDEELMMHTAAQGERYNFSKLDKVLDFLTANQLHPFLELAFKPIVLLDDRDSFIRYV
EREILFKDLESIREFLLAMMHHVINRYGMPEVSQWYFECWSDPRLIEKDNYERYFDIFET
TYSVIKNIAPGVHIGGAYDREYDVMTFDDMIHHWVDREIQPDFISIYCYQTRYKEYDLNM
MELSNRKLTRKNFLADYLSEQKKSMDRYGMNVPVIVGEWNMTVANRNILNDSCYKGAYVM
RSLMNMYPQAQMLGYWFGTDLFVEYEEAPKLLDGCGGLLSYHGIRKPAFYAVDFMNRLGN
YLLGKNENIMVTMDGYDNYMIACHNYKEQDAQYHLRDERELTIENIPLVFEDHSRLNTRV
QIRHVKNGSYYVKVRKINQKYGSIQDEWYQMGQLEELNTSDIKYLNNISVPHITIYKYEV
ENELLDIPIILEPHEIQYIHIFRQM

Enzyme Prediction     

No EC number prediction in MGYG000000127_02028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	324	753	7.9e-65	0.9698375870069605

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3664	XynB	1.71e-44	337	790	1	415	Beta-xylosidase [Carbohydrate transport and metabolism].
pfam01229	Glyco_hydro_39	1.60e-41	309	773	2	459	Glycosyl hydrolases family 39.
COG2207	AraC	2.22e-27	160	271	11	122	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	1.96e-26	186	267	2	83	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	2.30e-23	191	270	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR96769.1	8.46e-167	6	801	5	798
AGF58080.1	7.35e-165	6	801	5	798
BBG22497.1	6.44e-133	3	801	2	805
QCX34311.1	2.81e-125	25	796	29	823
QQQ92191.1	2.62e-124	25	805	20	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BS9_A	1.22e-45	324	801	17	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	3.07e-45	324	801	17	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BFG_A	4.18e-45	324	801	17	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
4M29_A	2.08e-35	336	769	37	464	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
6UQJ_A	2.32e-35	336	757	42	457	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	2.31e-42	324	801	17	481	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P36906	3.18e-32	309	773	3	451	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	4.28e-32	309	773	3	451	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
Q5HJR8	2.05e-31	13	784	4	723	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2
Q7A882	1.12e-30	13	784	4	723	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_02028.