CAZyme Information: MGYG000000127_04321

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_04321
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000127_8|CGC2	42404.46	4.812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 81906; End: 83000 Strand: -

Full Sequence      

MEKVIGVNFGNWLVLEKWMNVALFEGTTAEDEDELCRQLPREELVSRLTQHRDTYITKSD
FEYVKAHGVNTVRIPVPHFIFGDDPKYCDPYVPCIEYLDKAFDWADETGLKILIDLHTAP
ESQNGFDNGGICGVCKCFQSEELIGRLLVVLEKLAQRYGKREALWGIQLINEPISEQMWQ
FIQTRYLPHDPKRAEGSDFVPLNVLRRFYKDGYEVLRRHMDESKYVVMHDGFRFDAWTGF
MKEEHYKNVILDAHWYLGMGPGGVLDEGDYMRIILKEDVQKLQMMRDTMPVIIGEWCLSH
DTLAGRERTAVQKELFYRMVADAQLSAWDEGAGYFFWSYKLIGGPEGWDFRKAIENGWLP
EILV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	340	3.5e-102	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.61e-26	1	364	15	386	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	6.91e-05	51	173	20	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49144.1	2.85e-129	3	362	2	388
QOS79423.1	3.47e-126	1	360	1	367
QJU19071.1	1.91e-123	6	360	5	386
QQR01615.1	1.66e-121	6	360	5	386
ARE65151.1	1.66e-121	6	360	5	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	7.30e-106	3	360	2	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.87e-105	3	360	2	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.11e-38	2	364	11	395	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1CZ1_A	8.66e-38	6	361	11	380	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PF0_A	9.67e-38	6	361	17	386	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CR35	2.60e-49	2	360	38	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
B8N151	2.15e-48	2	360	29	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	2.15e-48	2	360	29	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
A2RAR6	1.47e-47	4	360	42	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q5B5X8	1.21e-46	2	364	27	395	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_04321.