CAZyme Information: MGYG000000127_04704

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_04704
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000000127_10|CGC1	85073.12	4.6091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 19599; End: 21914 Strand: +

Full Sequence      

MQIEDIIKSMSVEQKAWLCMGDNMWKTRAFPEYGLESVVMSDGTSGVRFQKGSEDEPKAV
FADSLSSSFDNADAVERTYKATAFPSGSSIACSWNTELVQRIGAALADECKALGIRLLLG
PGLNLRRHPYTGRNFEYYSEDPCLAGEMAAASVRGVQSKGIGSCLKHFACHNSDTHRTRV
DVTVDERALRELYLASFERAIEKSSPTCVMSAYNCINGEECSGNSRLVRDILKKEWNYDG
LVITDWGAVKDSVEATRGGIDFQMPWSPISANTLIGAVKSGAVDEALLDERVCRVLKFLE
YIEQGKAMDTDMDDRACVLERNHQLAVEAAKESIILLKNDHGTLPVTPEKYKKIVIAGQL
ACHPSFQGSGCAVVNPQRAEIPLDCLKELLEPGCEIVYCQGYTSDGSVSKELLDQAAAAA
EDASLVLVFAGTVLPEESDDYNRKTIRILPGHEALIKAMSGTGKPVAVILSGGDVCDMSW
SGEISALVATWYSGEGMGRALAELLCGRAAPSGKLPVSVPVKASDIPSSLSFPGDGFHLN
YSESIFVGYRYYDKKEMEPLFPFGFGLSYTDFEYSDMEIKERADEPAAYDVYVQVKNVGA
MAGSEIVQLYVRQDHPSVIRPVRELKGFTKLTLEPGEAKYAHFELHFRDFAYYSPQAGRW
LADNDSFNIEIGASSRDIRQSQSIRLENQAVYLPPLRYDCGFPEFFEREGAREKLFEFLQ
SRGIADASLLNDATVETLKGTFWSVRSFLDMYCESITYEDIDELIQSVGNA

Enzyme Prediction     

No EC number prediction in MGYG000000127_04704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	265	1.4e-64	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.51e-87	82	682	118	761	beta-glucosidase BglX.
COG1472	BglX	1.65e-68	81	396	80	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.67e-48	81	638	111	735	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.14e-44	75	296	79	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.52e-40	334	569	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU14504.1	1.05e-263	3	771	5	770
AKG35283.1	1.49e-263	3	771	5	770
AHV97918.1	1.71e-262	3	771	5	770
ADK80351.1	1.28e-231	3	751	7	759
QJU19736.1	2.69e-207	10	771	1	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.97e-186	3	770	5	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.95e-138	7	694	9	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.66e-120	2	694	3	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.15e-118	2	694	3	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	7.52e-95	3	689	6	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	6.17e-185	3	770	5	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.91e-137	7	694	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	5.78e-136	7	694	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A7LXS8	3.37e-131	2	679	45	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	7.54e-109	2	689	10	841	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_04704.