CAZyme Information: MGYG000000127_05179

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_05179
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
955	MGYG000000127_13|CGC1	104440.56	4.6813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 66025; End: 68892 Strand: -

Full Sequence      

MKFPQYFTEECFREEKPEVIEKKIEALIEAMTVEEKAELCHGGINPEFPGQVGNGGYLKG
VPRLGVPEIRMYDGPAGVTSIYETTGLPAEEMLASTWSRSLAGDFGRVTGSENKLISGNF
QLGAEVDLVRTTHFNRTRDMLGEDPYLAGELAVPLVKGIQENHVCAVLKHFAGYVVSANP
ANSPDTVIDEQTMHELYLTPFERSIRDGNACGIMTAYNRINGLYAANSAPLLKDVLREQW
DFKGLAMCDWGGNHSFSLKKGMDMEMPVGAYNSTERILRFLEEGSISMKDLNDAARHVLY
SLGAVGYLSSVALDCDGHVLEEPGRSEPVRMPDQYKGGSALLEANAGVAETIAEKGAVLL
KNQDETLPLTPEDLKDGQSVALVGMGAAYSICGYGQERSYGTLKYMISPAAQLQALSENP
QSFVVAPGINLVGTTIPPMYLRADVQGTVEGLNRYYGINTEDGYRPPAMSMGGAGEEFLG
TAAHDEDDDEDLDFKPMDLFIPGNDAADMEGHETGTLCCIDKIVEFTCGGQAFKKGSAYT
WKGWLTAPEDGEYQLNLQAIGGIAVFKMDVDGSGYKDMGLVKMREGTQWPWGNLVCTPEG
MEVCATRVHLNKGQRYPVIIYGKALLELKDLQLRLAWVTPSQALENRQNAIKAAASAQKT
VFFIHSGFKTAYGQAMGGLSFAEGTDLELETEQRELLMDLAHAAHSHGGRLIVAAYNGSA
FAMKPWIDAVDAMLYMWMPGQCGSRALARLLLGQAVPGGKLPQSFPNTNDDTLISDTPEH
KKERFDGVAVPGRPVKITASEGIYTGYRWYDENGRRPLFEFGYGLSYTTFSYSDLSLTRK
CSSVIVEFTVENTGKVTGDEIVQVYVGPGRAPEYAMMAKKQLCGFERLCDIAPGERRAVS
ITIPERCFMYWDVKKELQPYPDGTAGKWALAGGVRRLFVGASSLDIRLEGEVVIE

Enzyme Prediction     

No EC number prediction in MGYG000000127_05179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	60	267	2.2e-51	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.76e-52	24	914	38	736	beta-glucosidase BglX.
COG1472	BglX	5.61e-47	30	387	16	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.05e-34	63	299	63	314	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	5.31e-19	20	390	49	441	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.97e-18	634	827	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS04159.1	8.33e-233	3	952	34	993
BBM70396.1	2.55e-132	23	955	24	839
BBM73383.1	2.55e-132	23	955	24	839
AYA42665.1	1.92e-131	23	955	24	839
ACY48950.1	1.92e-131	23	955	24	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4I3G_A	4.56e-92	27	947	57	821	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	1.22e-68	22	950	2	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.50e-67	22	950	2	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.32e-60	57	955	29	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	2.88e-59	24	952	5	666	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5BFG8	7.14e-73	23	955	10	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	1.72e-67	24	947	2	803	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BA18	2.70e-62	61	955	40	830	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
B8NDE2	1.70e-61	57	911	29	797	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
Q2U8Y5	1.70e-61	57	939	29	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_05179.