CAZyme Information: MGYG000000127_05280

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_05280
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	MGYG000000127_14|CGC5	92167.63	6.5471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 97985; End: 100363 Strand: +

Full Sequence      

MDNRKKDFELYFMTGGSAREHMHQDVEFIYVMDGCIRVTALGKTFLLGGEDAMIINSNHR
HSWLEVEKTHLCIIHFNYSMLLEYLDKKLIFFYCNSSKESSERYEGIREIMDDLLSECAV
NADRMTFEKKSLLYRLLQYLIRYFMSDDILNTAEKDDLRIEEMLQYINTNYARSLSLQEM
AEYMHMAPSSFSRFFKKRAGITFVEYVNNVRLHFALEDILYTTNSVSWIAQTHGFANASV
FCKNFKAVYGMAPMVYRKQMANASAPQVSSGVDQQFLKKYLKRNESGIWESWKKQFIQAS
VDCRECRPWKNPWNEAVHLGTATELLNADLRSQIIESKEHLGFTYGRILGIFGSEMQFRA
EHAHKITNYNSMDSILDFLIRQKIRPIISLDNKPIIVFRSANSYLYEKKSELIFEDMTEC
KAILDDFLNHIVHRYGMSEVKTWKFDCWYDEFYENTMGIPGSFLKIFGGICGEIKRFIPD
AQVGGCGLSISINEKKFHDLLDTWVKEPVKPDFISINLYPYSQLNISGKLRAKRHLNTND
YYQSEVLRCRDVINEYGWADVPLYVIEWNMSMSQRNFFNDTCGKAALMVSQMVRLMDVVD
LAAYNGLSDLSGLYTDTSAFLMGGSGLLTASGVRKPAYYALQFMSRLGNLLVKKDANYIV
TTNGCDDYQILCFNAKNLRYKYYAKEESSIVPEEIEDIFENKDTIEITFSLTNLSEGDFF
VREYRVIPWRHSVLDAWKYMGTEYEMDAEDIEYLKSICVPVQKKGRLKVSGGKLVFQQSI
RDQEIKFIHLYR

Enzyme Prediction     

No EC number prediction in MGYG000000127_05280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	309	742	1.2e-50	0.9767981438515081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.20e-34	304	766	9	463	Glycosyl hydrolases family 39.
COG3664	XynB	1.05e-24	325	792	1	426	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	7.31e-24	159	265	21	127	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	5.95e-22	175	257	2	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	1.28e-19	180	259	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58080.1	4.65e-144	21	790	24	798
AQR96769.1	2.56e-143	21	790	24	798
QQQ92191.1	4.47e-135	7	792	6	798
QJU15301.1	4.47e-135	7	792	6	798
ASU27451.1	4.97e-135	7	792	10	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M29_A	4.01e-27	325	790	38	496	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	7.17e-27	325	790	38	496	ChainA, Beta-xylosidase [Caulobacter vibrioides]
1W91_A	4.20e-26	310	790	15	480	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	7.50e-26	310	790	15	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6UQJ_A	1.40e-25	325	664	43	383	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	6.39e-25	313	647	24	356	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q936F1	1.76e-24	51	760	48	710	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2
Q9ZFM2	1.33e-23	310	771	15	463	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
Q5HJR8	2.16e-23	51	760	48	710	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2
Q6GD21	2.86e-23	51	760	48	710	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_05280.