CAZyme Information: MGYG000000129_02234

Basic Information

• Species: Marseille-P4683 sp900232885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Marseille-P4683; Marseille-P4683 sp900232885
• CAZyme ID: MGYG000000129_02234
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1603		177991.99	4.1219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000129	2720267	Isolate	Canada	North America

• Gene Location: Start: 23818; End: 28629 Strand: -

Full Sequence      

MKWWKQALGILLSIVLLVPLAVTPWANLGASANGAIAEIQVNNLKVCSLTDPLGIDKDPV
FSWVVSGSAKDDKQDSYQIVLATDEEDAAQGKGTVWDSGKIAGEDTIDIAYSGPALNSRT
TYFWKVTVWSHRGGQASSEVHRFSTGILDGNWEGQWIGFPQEQCDVGLTGANWIWNRGSD
PFEGAAAGTQYFRFSFAIPEGKSVERFELAYTVDDNATIYLNGKEVGSIDLWSDGSFYNQ
VDGLVPGENVVAVRATNATVGYAGMIANIRITYSDGSQDTHSSDQTWKVSSHATDGWQNI
GYDDSAWGTPDQAVAFGSSPWGTGVSLKAVGSRAAVLLRKDFEIDKPVKEAYAYICGLGF
FDLKLNEKAPDDSVLNPFITQYDQAVLYRTFDVTSLLQEGGNAIGVELGSSYYNEIGGVW
NWGTAAWRDDPKLMFRLDIRYQDGSSDTIVSDPSWTSTNDGPIASNSMYYGDVYDARKEM
TGYASAGYDDSSWQPASVAKTPSGTLEAQMKAPVSKVASFEPEEIVKLGEGSYRIESPEM
VSGWILLKNIQQDAGDKITITYGQKLDEDGSVHKYGGDDGELSSWYPHAYFQQDIYYASG
NAPESYEPKFSYKGFEYVQIDGYDGELTKDDVVIYRVSNDVEVLSEFESSNEMFNRLHQS
MRVAMTDNFQGEHCDPMLEKNGWLGDANVSLGSMMFTFDMPATLPGWIEVMEDCQEQYGL
VPQMVPTANWGISNAAVWNTIFVYGVQDLERYFGTGAYTEEQYDAMRQFALRDIQEVSQN
NWVWRDDDPLADWVSPIGGNNPNVNYDEHSSEGSGIVGTAFVYGMLEAMAEFADDLGKTD
DAAEYRSAMENIYQAFNEKFYNEQAGIYETTVWTQIGNRTKYRQTSNLVPLAFGLVPEDR
VESVLTHLVEDIIGKEYHLDTGCVGTRYILPILCDYGYEDIAYRIATQTTYPSWGYWLQS
DSKSTWEMWEATTRSFDHYFLGTYEEWFYSHLAGIQDVDNGYQTFTIAPEIIGDLEDVSA
TVQTVRGELASSWQRNDDGTASMQVTVPFGSTAAILFPTADKENVILGGSPISTDMEGVR
SVEAQDGQVCVTVGSGTYEFKTATDLISVYRLALEEIVAEAEDYLEDPLYESAKEQLEAQ
VASAKGVLEDSSASQQQVNEAAQNLREFLSAMVGSESRIQLRQLIVECQKMRLEGYYLPD
AWQSYQSVLAEAKQMVEDLSADDSALNQMITSLQEADKQLDTAMYPNLALGKQPSASSTN
ESPHWGWGLQFATDGDRKNASPQEGEYAGYCSSQSASVNHAEWLQVDLGSVHTVNHVVFY
PSSSWNGEKWLSYGFPVDFRIQLSDDGTTWRTVHDIKDYPLPEYGPLSFAFPSQEARYVR
LCADSLRPKPSDNNSYHLQICEMEVYSLPEPEEIVTPDKDSYLTGETITLTIRTEKEVDG
ITLFNENGRALGLTKVKSIIQDDEKIWTIQTAVETPGDRTIQVMARKGGVWTALADFSIQ
VVRPEVPEAVIYEASVQTREASVNERFTVEIQTNQYAESIVVKNERGKAVTCRVESCEEQ
GEKRLFIVSMEVGTAGDRILSFYAVNGNGELSRVSAEASVRIK

Enzyme Prediction     

No EC number prediction in MGYG000000129_02234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	526	1055	3.9e-124	0.9920634920634921
CBM67	171	321	6.9e-32	0.9943181818181818
CBM67	333	502	4e-31	0.8920454545454546
CBM32	1256	1403	1.5e-19	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.31e-80	645	992	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.18e-56	346	517	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.60e-14	527	635	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00754	F5_F8_type_C	5.53e-14	1255	1403	3	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17390	Bac_rhamnosid_C	1.12e-13	994	1063	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59736.1	0.0	1	1603	1	1603
QYJ14959.1	5.90e-236	6	1100	5	1079
AQS56111.1	1.73e-231	81	1100	1	1014
SDU74751.1	5.02e-210	59	1100	67	1086
AZM64016.1	2.24e-203	53	1100	57	1080

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.00e-132	36	1100	1	1028	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	7.44e-127	43	1100	34	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	3.20e-69	336	1068	132	857	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6T0Q_A	2.28e-16	137	325	164	348	PleurotusOstreatus Lectin (POL), apo form [Pleurotus ostreatus]
6T1D_A	2.37e-16	137	325	167	351	PleurotusOstreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_B Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_C Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_D Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_E Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_F Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.22e-131	36	1100	1	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	2.85e-91	50	1099	41	946	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.76e-87	338	1106	177	926	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	7.78e-70	338	1058	173	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	1.23e-16	615	1072	700	1151	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.371206	0.620173	0.005369	0.001146	0.000635	0.001458

TMHMM  Annotations     

start	end
7	29