CAZyme Information: MGYG000000131_00593

Basic Information

• Species: Anaerotruncus rubiinfantis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Anaerotruncus; Anaerotruncus rubiinfantis
• CAZyme ID: MGYG000000131_00593
• CAZy Family: GT111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000000131_2|CGC2	72386.63	6.7372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000131	3305807	Isolate	Canada	North America

• Gene Location: Start: 130556; End: 132433 Strand: +

Full Sequence      

MPNIKILISCHKEADHPESEILLPIQVGAANARVRFPDMLHDDEGENISDKNPMYCELTA
QYWAWKNLDADYYGFCHYRRYFNFSDTVYEEDPWGNVLEDYVDANAAQKYGFDDQTIADL
VARYDVITTTRKDLRRMPERFSSVDDQYAKAQKLHAKDLQTIREIIDEKFPAYSLAAKKH
CEGHTTSFCNMYILRKEIFADYCAWMFAVLAEFEKRTDMSRYSQEALRTPGHLSERLFGI
YYIYLQERGRTLKTKELQCVLFADTDPQRMLAPAFPENEIPVVFAANNNFVPVAATCIQS
VIEHAAPGKNYDLVLLESDVTRENKDILLGMLKGKPNISLRFFNAARLLSGYELKANAHI
SVETYFRFLIQEILPGCGKVLYLDCDLVAQEDVAKLYETDVEGYLLAAARDPDFLGQING
ANPATAAYCKKGLPMKDPYNYFQAGVLLFNTAEMRKAYSLSEWLTFATHPYKYNDQDVLN
LYCEGRVKYLDMVWNLITDCDHYRVNNVVVYAPDAVYKEYQKAHAAPKIIHYAGFMKPWH
RPDEDLARYFWDYARRTPYYEQLIFRMDAGNAWHVANGLYRERGLRGFFRGILGLPRRVV
DRFLPKGSAGREKLKKIYHIFVKAK

Enzyme Prediction     

No EC number prediction in MGYG000000131_00593.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT111	6	242	1.4e-73	0.9815668202764977
GT8	277	541	5e-54	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14393	DUF4422	1.00e-91	5	244	1	218	Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.
cd04194	GT8_A4GalT_like	4.72e-65	280	540	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	1.35e-39	281	541	1	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	5.07e-36	278	560	1	267	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	1.71e-20	282	541	4	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXR42339.1	3.16e-200	3	617	385	998
AMK58470.1	3.76e-200	4	617	1	615
QOL36192.1	4.86e-200	5	615	388	999
AGH40654.1	8.64e-200	4	617	387	998
AII76924.1	1.62e-198	4	617	391	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	6.30e-101	3	566	28	595	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	1.81e-22	282	541	3	254	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	2.01e-21	282	541	3	254	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	2.35e-18	282	541	41	280	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URH2	7.08e-16	282	568	5	258	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P25148	1.28e-10	282	539	9	255	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
A0A0H2URH7	1.70e-10	282	547	305	530	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H2URA3	1.21e-09	278	551	2	247	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000131_00593.