CAZyme Information: MGYG000000132_00690

Basic Information

• Species: Beduini sp902363625
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Beduini; Beduini sp902363625
• CAZyme ID: MGYG000000132_00690
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000000132_2|CGC6	56832.67	5.1827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000132	2897757	Isolate	Canada	North America

• Gene Location: Start: 274215; End: 275696 Strand: -

Full Sequence      

MSYPKGFLWGGAVAANQCEGAWLEDGKQPNVTDVMVGIANKNPSIKWNEETSKWEMALDP
NKVYLSHEAIDFYHRYKEDLKLMAGMGFKAFRTSIAWGRIFPNGDEIQPNEAGLKFYEDM
IDTMIELGMEPVITLSHYETPLHLLTEYGGWSNHQLIEFWKRYVTTVFERYKGKVKYWLT
FNEVNNMKHMPFVASAVLNINPKDKNDPIGSITEQEKWQAYYNICVANAWTVKICKEIDP
KAKVGCMLTSSCVATYPYNCDPDNVFGAYDAQRMSNFYFGDAFCLGIIPGYVKRVWREQN
CEPKMCNDELKLIKENTVEFFSLSYYRSSTFEGTVSLGDTGGLIGKENPYLTGCSPEPWR
WPIDPKGIRYILNVLYDRYHLPLFIVENGIGLDEAPDQNGEIDDPERMKYVEDHLHYIHE
AILDGVEVMGYLYWGPIDIVSAGTGEMRKRYGFVYVDRHNDGSGTMERKIKNSYYRYKEI
IETNGECLLKKDK

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	485	4.8e-134	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.51e-179	1	486	2	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	1.08e-174	2	488	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	5.57e-163	1	488	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	4.60e-162	1	488	4	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.42e-153	1	488	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN13105.1	5.10e-307	1	490	1	491
BCL58448.1	2.56e-261	1	489	1	491
AMB97653.1	4.25e-225	3	488	7	492
SNU89742.1	1.66e-224	3	485	7	491
QTU82787.1	7.50e-224	3	488	7	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.25e-155	3	488	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.03e-148	1	488	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	1.02e-142	3	490	20	487	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	3.54e-136	4	486	8	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.00e-135	4	486	8	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.78e-154	3	488	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.77e-152	1	488	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	1.11e-147	1	488	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P24240	3.21e-143	3	488	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	1.39e-140	4	488	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999971	0.000082	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000132_00690.