CAZyme Information: MGYG000000132_01408

Basic Information

• Species: Beduini sp902363625
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Beduini; Beduini sp902363625
• CAZyme ID: MGYG000000132_01408
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000000132_4|CGC3	55763.29	5.8776

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000132	2897757	Isolate	Canada	North America

• Gene Location: Start: 267578; End: 269014 Strand: +

Full Sequence      

MKKNPDQFPNHFLWGGALAANQCEGAYDVGGKGLCIADINPYKDNVALKKKSNKEMSSKD
IESLLHDPSMVFPKRYAIDFYHTYKEDLKLLAGTGMNSLRISINWARIFPNGDETEPNEE
GLAFYDHLIDEIIKNKMEPMVTISHYEMPLHLATHYNGWYNRQLIEFFVRYCETLFKRYH
DKVKYWILVNQMNLIKYESFNHLGIPSDRVENLLEAKYQGVHHELVACALSIDIAKKIDP
SMQIGMMSYYANCYPETSDSKDVMAAMRINQMEFFYSDILVRGEYPKYAYRFFEENNLDI
KITNEDLEAFKHTVDFVSFSYYYTKITSAKNYGTEEAVKINPHIKTNEWGWGIDPVGLRV
ALNEYYDRYQLPIYVTENGMGFIETLNEDGTLHDPYRIEFLREHIRQIKEAIKDGVDVRG
YYPWGPIDIVSCSSSEMKKRYGFIYVDLDDYGKGSGKRSLKDSYYWYQTVTKSNGEIL

Enzyme Prediction     

No EC number prediction in MGYG000000132_01408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	475	6.1e-137	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	7	478	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	1.69e-178	7	477	3	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	6.20e-175	8	478	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	2.64e-169	8	476	6	475	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.58e-146	8	478	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZQ42336.1	1.37e-269	1	478	1	478
QNM44223.1	8.10e-253	1	478	1	478
AST97784.1	8.10e-253	1	478	1	478
ARA86528.1	1.50e-250	1	478	1	478
QFY38076.1	1.50e-250	1	478	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.39e-161	1	478	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	2.33e-145	8	478	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	9.18e-141	8	475	11	477	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	1.26e-140	7	476	6	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.57e-140	7	476	6	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	3.50e-163	1	478	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	3.61e-149	8	478	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46130	7.63e-148	8	478	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	2.65e-147	9	478	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	4.50e-147	8	478	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000132_01408.