CAZyme Information: MGYG000000135_01020

Basic Information

• Species: Murimonas intestini
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Murimonas; Murimonas intestini
• CAZyme ID: MGYG000000135_01020
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	MGYG000000135_2|CGC2	62493.52	4.9047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000135	5745007	Isolate	Canada	North America

• Gene Location: Start: 173035; End: 174714 Strand: -

Full Sequence      

MIDLKGNPFFLDEKQEAWVCKTFADMSAEDKLGQIFCETIWNCNDEEEEMAFSGINPGGI
MFRGGTREELVKYVRRMSRRSHIPLLFSGNFECGGNGVLTTGTFFGSPMQIAAAGETRFA
KIVGEISAKEGGEVGCNWSYAPIIDINYNFMSPVTCTRTYGSDPDTVIEMAKAYMDGCHD
NGMAVAIKHFPGDGMDFRDQHWLASVNTKSVTEWDETYGKVYKALIEAGADSVMAAHIKC
PACSKYYNPDQEDRDILPASLSPELLNGLLRGRLGFNGVIVSDDTHMAGFTNAMARDKAV
PYMIAAGIDMMLFTVNHDEDVAFMKKGYEDGIITPERLDDAVMRILALKAKLRLYERPLP
EEKPENSCIRCEKHEKLAYECADSAVTLVKDRDKILPITPEKYRRILLVNIESVKSVRYS
TDSQYLNFLEGLREKGFEVSEIDIQQIPSIGKGGASFGEISEKYDLMLYYLGAKAGYRIV
WKSVVMGEIPSYTKDIPTVAVSFQSPYLLMDIPMVGTYINAYTETKYTRRAVLKKLTGES
EFKGSSPADPFCGMWDLKL

Enzyme Prediction     

No EC number prediction in MGYG000000135_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	312	6e-53	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.61e-59	26	404	1	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.76e-49	29	348	3	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	6.76e-21	117	322	96	286	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.17e-12	13	409	32	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ37106.1	9.13e-172	1	559	1	566
AIQ24904.1	3.10e-167	1	559	1	566
ASA19767.1	3.31e-167	1	559	1	568
AYA78616.1	1.34e-164	4	559	8	571
AIQ21950.1	5.21e-163	2	559	5	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.66e-155	4	559	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	2.26e-39	26	409	42	458	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	5.95e-39	5	409	17	462	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	8.31e-39	26	409	16	432	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
6K5J_A	6.66e-37	82	548	75	529	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.73e-145	1	559	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.24e-38	26	409	42	458	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
C4LEY6	5.50e-23	45	335	14	293	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q3J953	1.52e-22	118	312	99	281	Beta-hexosaminidase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=nagZ PE=3 SV=1
P48823	3.74e-21	80	398	95	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000135_01020.