CAZyme Information: MGYG000000135_01309

Basic Information

• Species: Murimonas intestini
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Murimonas; Murimonas intestini
• CAZyme ID: MGYG000000135_01309
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000000135_2|CGC7	51814.05	5.0285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000135	5745007	Isolate	Canada	North America

• Gene Location: Start: 485780; End: 487162 Strand: -

Full Sequence      

MYIKNDRAEDVKITYIGGGSRGWAWNLMSDLAVEDQMSGTVTLYDIDIEAARNNVIIGER
LQEAGGEKNFCYHACGNLREALQGADFVVISILPGTFEEMEYDVHYPEKYGIYQSVGDTA
GPGGIFRALRTLPMYVEIANAIKEVSPDAWVINYTNPMGACVRMLYEVFTDIKAFGCCHE
VFGTQELLAHLAETEYGVDKIDRREIEVNVQGLNHFTWIKEAAYKGKDLFPLYAKAADKY
RDGLEYEEGRSWLNSYFANANCVKFDLFRRFGLIAAAGDRHLAEFCPGWYLKDPEVVKGY
KFSLTPVSWRKENLKKLLEKSRKRVSGEEEVKIEPSGEEGVRQMKAIAGLGSYITNVNMP
NRGQIRNIEDGVVVETNAVFSCNSVRPVVTGDMEKNIMELTRPHIYTQNAVVEACMKQSL
KPAFKAFASEALVCLPIKEAEELFEGMVRGTSKYLGYYTE

Enzyme Prediction     

No EC number prediction in MGYG000000135_01309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	190	1.5e-57	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	8.39e-151	11	448	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	2.17e-101	11	455	4	436	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.03e-69	11	414	2	384	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.46e-60	12	189	1	178	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	3.26e-54	12	455	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00783.1	3.05e-196	6	455	6	457
AGC67847.1	6.13e-196	6	455	6	457
ANW98258.1	6.13e-196	6	455	6	457
AGI38887.1	6.13e-196	6	455	6	457
AFK85236.1	1.76e-186	1	455	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	1.91e-143	9	444	4	432	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1OBB_A	1.66e-24	11	421	4	439	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
5C3M_A	3.09e-21	11	433	5	413	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	7.68e-21	11	433	8	416	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	6.87e-20	2	426	20	433	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	3.52e-187	1	455	1	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	4.50e-175	1	455	1	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	4.99e-175	1	455	1	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	1.63e-148	9	449	8	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	3.94e-47	12	426	3	397	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000135_01309.