CAZyme Information: MGYG000000135_03984

Basic Information

• Species: Murimonas intestini
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Murimonas; Murimonas intestini
• CAZyme ID: MGYG000000135_03984
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685	MGYG000000135_9|CGC8	78502.83	5.5752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000135	5745007	Isolate	Canada	North America

• Gene Location: Start: 173798; End: 175855 Strand: +

Full Sequence      

MREKNSLKLRGRQIHLDFHTSPLIPGVGKEFDAREFASVLKQAHVDSVTCFARCHHGMLY
YDSKRFPERVHPGLENKNMLKEMIEECHRVGIKVPVYTTVQWDYYTAMEHPEWLAMDEHG
MQIGQEPYEAGFYQTLCVNTGYKEFLKEHIAELLEELDVDGIFLDILYPRDCSCHVCRRE
MERAGIDVKDPARRLAYGQKMIDDFKFEISEFIRSFRKDVSIFYNTSHIGVKQRPVLDAY
THLELESIPGGWGYVHFPVTMRYARTLGLDCVSHTGGFHVEWGDLHSFKTQEALEYECFR
MLAMGCKCLVGDQMEADGKLLEPLYEKIGKVYERVEALEPWCDDAVQVTEAAVLTPEEFH
GGDRGHLNASLMGLENMFDKLALQFDIIDSQADFERYPLLILPDNIPVDERLKKKLDSYL
ESGGRMIITFESGFAEDGERYMLCRETGIEALRAPLRTSEGGLARGIITNSNDYAEYIMP
GEVIGKRLPKTEHVMYAKGVEVARTAGDVQVMARFVPPYFYRSFEHFSSHRQAPSTHRLS
DPAIIRRGNVIYFASPVFAIYNARAPRWCLEMMNDAVMELLGKKMVVHDGPSTLFASLNV
QEEKKRYILHLLHYIPEKIAEDLHTVEDVIPLSDLHIKLNLDKEAESAVLVPEGKPLDIR
AGDGSVEFTLPRLEGYQAVEIRFRD

Enzyme Prediction     

No EC number prediction in MGYG000000135_03984.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	32	166	1.7e-51	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	1.20e-43	32	166	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd03143	A4_beta-galactosidase_middle_domain	2.00e-10	380	466	37	117	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08532	Glyco_hydro_42M	8.02e-07	378	485	39	158	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd14791	GH36	0.001	60	168	57	154	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam09822	ABC_transp_aux	0.010	364	452	153	250	ABC-type uncharacterized transport system. This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97446.1	1.98e-251	5	682	2	662
BAL99835.1	6.55e-234	12	683	11	681
QGQ95137.1	6.67e-230	6	683	2	686
QRT30085.1	3.26e-222	8	683	3	664
QHB23844.1	6.55e-222	8	683	3	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVK_AAA	5.70e-129	9	685	30	689	ChainAAA, Alpha-L-fucosidase [Paenibacillus thiaminolyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000135_03984.