CAZyme Information: MGYG000000136_01153

Basic Information

• Species: Agathobacter sp000434275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp000434275
• CAZyme ID: MGYG000000136_01153
• CAZy Family: CBM86
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1358	MGYG000000136_4|CGC2	147801.64	5.0961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000136	3864408	Isolate	Canada	North America

• Gene Location: Start: 98877; End: 102953 Strand: +

Full Sequence      

MWKMGACIALSAAMTLTSVGSMLPSDWGIETVYADETQTTIKTFTADQLEVSWGNAKYKR
ENGQWKLTFANQYDQVKWKVPETIALSDVKSVTFHVADQIGSVTLKVYNGGDDAEGANTQ
YGLTGNKEYTIEPSGEGIVDAVGLMTTDDTGSGSKVSLISVTFELKEGSGSQNTYGDNII
KDGDFKSDNAADSWNASAGKSTITVGTEKNEIGDSGLKTYGVINRDPATASSGDCFSQDI
TNAVERGEEYQYSFWAKLSDDYKDAPEEQRNVDFAPFYVAGGEATYLGSYSTGVLSGEVT
KTLTAGEWTKFSGTFNVPKTADQIVIRIIEQGTDYGQGKCVKGAYCVTGVSMKKITKPKP
EIEKDIPDWKTSVTESLGNDSIAGTAIMSSEISDDTLMELVEKHFNAVTLGNELKPDALF
NYQIGQSVDCKTITFKGTELKVPVVNDKNENLDFSRADAMLEKILEWNNANPKNKIRVRG
HVLVWHSQTPEWFFHEDYDVAKPYVDKETMNRRLEWFISSVFDHYFGKAANGKYDGLFYG
WDVVNEAVNGNTYRDDKVIPDESDTSTSDTRHGSNSMWWRVYQSNEFIINAFKYANHYAP
EDVELYYNDYGETDNTKCEGIVKLINDVKHAAGTRLDAFGMQAHYNVDGFSAAQFKSVAK
KYAQAAGKVQLTELDFKASSTYDGTAATKESEYTKMAYCHKNLYEAIKALKNEGTNVSGL
TVWGVIEPNSWLHSQSNVGGGANGSAQCPLLFDGNYKAKPAYWAYVDASQLKPAIQKVTI
TEAKDGNIAGETYTIDQGEVQAEFIPVWDAAGLTVQVKVKDTTANDADAVTVYVDPKNSA
SDITPDKATVARTAAAEIAGGYQATVKVPMENLKVAQQIGLDVVVNNDGKTESFNDLTGN
QESSSKYYAVATMKPGIEKIPYGTISVDGEEDAAWNNAVNIPLTINKGSEASANAKVLWD
DDNLYVYATIKDAVLDKTGAQTHEQDSLEVFIDEDNGKTASYGEDDKQYRINYDNEQSFN
GKKCLAENVKSATKTIVGGYVVEAAFKWTDIRPANGTKIGLDLQINDAKGGKRTGTLSWY
DETGMGWSGSNVYGTVELTGKTGSNGGGSSVNPGTSDTKPDVKPDGKQDTTVETSKVEIT
VSGDKNAEASVTITKDAQGNVTGANATVSGSKGTLTTDVVKQLTEAAGTEDLTIIMQVKN
ANGDVKYTVSVSAENVKNNKSLKAFVVNRKTGEYELINSKTYKAKDGKLNASFGKKGDYV
LLTTKEAARIEKEILKTIAPKKTKATVKKGKTTEFKLDSKLNQNNVKKVTYKTSKKSIAT
VNKNGKIKTNRKGTVTIKAIVTLKNGKTKTVSMKIAVR

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	380	768	2.1e-81	0.9636963696369637
CBM9	927	1098	1.1e-49	0.9945054945054945
CBM86	52	161	1.3e-34	0.9906542056074766
CBM22	178	328	5.5e-19	0.9618320610687023

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00005	CBM9_like_1	2.57e-75	922	1099	6	185	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam00331	Glyco_hydro_10	6.95e-68	384	767	13	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	8.77e-68	451	764	12	262	Glycosyl hydrolase family 10.
pfam06452	CBM9_1	1.98e-56	927	1099	1	182	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd20907	CBM86	2.88e-47	40	166	1	127	carbohydrate binding module family 86. This family describes what is most likely a xylan-binding module such as found in the Xyn10A protein of Roseburia intestinalis L1-82, which is involved in the extracellular capture and breakdown of xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24088.1	0.0	2	1098	5	1101
CBL13458.1	0.0	14	1098	1	1085
EEV01588.1	0.0	14	1098	1	1085
QJU17095.1	7.59e-281	176	1099	230	1147
BAA09971.1	1.00e-244	177	1096	44	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SGF_A	3.21e-49	42	170	7	135	Molecularinsight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_B Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_C Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_D Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_E Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82],6SGF_F Molecular insight into a new low affinity xylan binding module CBM86, from the xylanolytic gut symbiont Roseburia intestinalis. [Roseburia intestinalis L1-82]
2W5F_A	9.32e-48	213	762	53	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
2WYS_A	1.10e-45	213	762	53	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6D5C_A	1.30e-45	367	768	16	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
5OFJ_A	4.51e-45	366	769	3	339	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36917	1.11e-100	237	1101	246	1045	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
P38535	2.29e-95	178	1101	38	897	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
Q60042	6.50e-95	302	1098	301	1053	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
Q60037	4.42e-94	302	1098	305	1057	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
O69230	7.99e-86	206	1098	217	1083	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002278	0.996434	0.000346	0.000389	0.000289	0.000253

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000136_01153.