CAZyme Information: MGYG000000136_01211

Basic Information

• Species: Agathobacter sp000434275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp000434275
• CAZyme ID: MGYG000000136_01211
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000000136_4|CGC3	62647.17	10.0658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000136	3864408	Isolate	Canada	North America

• Gene Location: Start: 161611; End: 163359 Strand: +

Full Sequence      

MKNKRKRLLSIVLSCTILISGGGLFSNIDVAKAATNAAFSTEMKAAGFPDSYITGLTQLH
KQYPQWKFEAVDTGLDWGTVITKESVNGVNLVPKSVDDARKSTAAGAYDWNTNIWTIYDG
SNWVAANSGYIAYYMDPRNFLNETDIFQFESLSFNKSQTKSGVNAILSGTFMAKTVKDAD
KTTLNYADSFMKIGELTGVSPYHLASRVRQEQGLNGTSSLISGTYKGYEGYFNYFNVGAA
GVTSTLVIRNGLAYAKKAGWNTRYKALLGGSQLLAKNYIAVGQDTLYFQKFNVVNAKNLY
GHQYMSNLTAAYTEGRKLGQGYTDKQQAFVFRIPVYKSMPSSAVTFTATGNPNNYLKNIA
VAGQSLTPGFKSATTKYSMVVENTVSSISVNATAVAATSTITGTGTKKLSVGTNTINVKC
KSGSGSTRTYKLTVVRKEAAKPTGTLSSAKYTVGDKYITGIVPGTRAADFLAGLSVDGGT
AKLVGTDGKQNQGLVATGNKVKVYVNNKKKTSYKVVIYGDVNGDGEINVLDMIKVNRHIL
GLDKLSGTYLVAADANHMGDGLNVLDMIYINRHALGLSTIKQ

Enzyme Prediction     

No EC number prediction in MGYG000000136_01211.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	4.70e-23	112	337	38	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
cd14256	Dockerin_I	8.84e-15	518	575	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	1.22e-07	519	572	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
pfam12733	Cadherin-like	1.93e-07	365	436	5	88	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
cd14256	Dockerin_I	1.45e-04	500	540	17	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK92679.1	5.07e-176	32	561	222	768
ACR76042.1	2.57e-173	32	561	222	768
CBK91761.1	5.13e-173	32	561	222	768
AEN96074.1	9.80e-154	35	556	210	736
ACR71571.1	2.37e-103	36	554	120	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FXO_A	1.14e-12	123	337	37	244	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
6FXP_A	5.44e-09	123	337	46	246	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus Mu50],6FXP_B Chain B, Uncharacterized protein [Staphylococcus aureus subsp. aureus Mu50]
6U0O_B	1.08e-08	123	337	76	276	ChainB, LYZ2 domain-containing protein [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CPQ1	5.38e-12	123	337	1128	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1
O33635	1.23e-11	123	337	1128	1335	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q5HQB9	1.23e-11	123	337	1128	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
Q5HH31	3.64e-11	123	337	1049	1256	Bifunctional autolysin OS=Staphylococcus aureus (strain COL) OX=93062 GN=atl PE=3 SV=1
Q6GAG0	4.78e-11	123	337	1043	1250	Bifunctional autolysin OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=atl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000572	0.997349	0.001298	0.000361	0.000216	0.000167

TMHMM  Annotations     

start	end
9	31