CAZyme Information: MGYG000000137_01005

Basic Information

• Species: UBA7160 sp902363665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp902363665
• CAZyme ID: MGYG000000137_01005
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802	MGYG000000137_4|CGC1	88937.14	5.0225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000137	4141348	Isolate	United Kingdom	Europe

• Gene Location: Start: 132382; End: 134790 Strand: +

Full Sequence      

MKKYKDSSLPVEERVRDLMERMSFEQKIDQITCLVTITPDVPNFKDYIPNGIGHVGAFTT
AENVEKIVEYANTLQHYLTEETELGIPALIHCEASAGAQFTEADVFPSAIAQASTFHSDI
VVKMAEVIREQMHEVGFRQALSPVVDIARDPRWGRTTETYGEDPTLTAEMSVAFVKGLQT
DDLKNGLLCTEKHYIGHGITEGGLNMGRNLVTERELREVHGKPFQAAITEAGLGSVMSSY
CSMNGEPVSGSRKLLTDLLRGEMGFQGIVVSDYVAVDRLVDPFQVAADYTEAGIRSLKAG
LDVEYPRPKGFSYRMKEAVEDGRLSMADIDQAVERVLTQKIKLGLFEDPYPHLDRLKALL
HQKSTDELNEKMALESFILLKNERKTLPLSKKTKRIAVIGPHADVLRSYFGTFSYPAALD
MTMAREEDGQGFDEPGLIVYDIEQKYPGQLRDCSPRLERRLQAEFAKCRTLYQALKEYLP
DAEITYAKGINAVGSDLSGMEEALNTAAEADVVLFTIGGKNGWGITSTVGEGVDSTNIDL
PGRQEEFARAIYALHKKTVVLHFDGRPLSNAFIASHFDAILEVWQPGMMGGQALCKVLFG
DYNPAGRLPVTAARSVGQIPVYYALPRGSGYVAAGHTGMIRNKNGYINDSAFPLYYFGHG
LSYTTFAYSDLEIAKKELSPEEELEVTVKVTNTGEYDGEEVVQLYVSDDVASMVRPTMEL
AGFARVFIPKGESRTVRFKMKATQFAFLNEAMEWTVEKGTMTVKVGASSADIRLEDQFTI
TQTRVIDGKTRGFYAKTEVLEK

Enzyme Prediction     

No EC number prediction in MGYG000000137_01005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	305	1.6e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.85e-152	9	780	29	764	beta-glucosidase BglX.
COG1472	BglX	1.87e-90	22	419	1	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.31e-72	23	338	1	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	4.36e-68	6	766	44	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	5.61e-48	378	663	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT51214.1	0.0	1	799	1	799
AIQ31495.1	1.18e-252	4	797	7	802
AGU09729.1	1.96e-232	15	799	19	804
AEI40406.1	1.59e-225	4	799	8	812
AFH61237.1	4.51e-225	4	799	8	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.48e-113	18	773	17	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	5.52e-113	3	773	6	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z87_A	1.77e-112	4	773	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXN_A	1.87e-112	18	773	17	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
7EAP_A	4.16e-112	3	773	6	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.25e-116	73	783	45	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	3.52e-109	15	773	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.69e-108	15	773	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.73e-105	2	773	27	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.92e-86	11	772	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000137_01005.