CAZyme Information: MGYG000000138_00580

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_00580
• CAZy Family: CBM51
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		52463.47	6.3717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 253786; End: 255192 Strand: +

Full Sequence      

MKTLQLICLSGALVSCLNGCKQAGQEEHVPFNVIYILADDLGYGDVGCYGQKLIKTPHLD
EMASQGMLFTQHYAGCTVSAPSRASLMTGLHTGHTLIRGNKGVKPEGQMPMPEGTYSLGK
LFQSCGYATGVFGKWGLGFPGSSSEPGKMGFDEFYGYNCQGLAHSYYPDHLWHNQEKVVF
PENVDNGRKTYSHDLIHRQALQFIKDHRSQPFFAMLTYTLPHAEINLPHDSIYQLYEDKF
EEQPYDKPGSYYRSEKPHASFAAMVSRLDMYVGDILAELKQLGLDKNTIVFFTSDNGPHQ
EGGADPAFFNSSGPLRGIKRDLYEGGVRVPMIVWAPKLVKAGSSSDHVCAFWDMMPTFAE
LIGGTIPEKGDGISFLPTLLSKEGQKKHDYLYWEFHEQGGRQAIRKGDWKLIRQGISSPN
GSWLELYNLKDDVHEDTNLIEKQENIAMELDKLMNQVRVQSEIFNFGK

Enzyme Prediction     

No EC number prediction in MGYG000000138_00580.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16145	ARS_like	0.0	32	439	2	410	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16144	ARS_like	1.08e-133	32	456	2	420	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	2.59e-110	32	440	3	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16143	ARS_like	2.69e-108	32	440	2	395	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	3.29e-106	32	452	2	399	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD59786.1	1.44e-108	32	439	38	447
AJF68301.1	3.13e-106	24	454	42	474
CCA60043.1	1.24e-104	32	454	46	471
QES02769.1	1.24e-104	32	454	46	471
QES09751.1	3.44e-104	32	454	46	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AN1_AAA	1.07e-138	18	447	17	485	ChainAAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482],7OQD_AAA Chain AAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482]
7ANA_AAA	9.48e-130	18	458	17	498	ChainAAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANA_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_AAA Chain AAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482]
6PSM_A	6.64e-61	18	442	12	421	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	3.56e-60	18	442	12	421	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]
6B0K_A	6.16e-52	32	435	4	396	Crystalstructure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas],6B0K_B Crystal structure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas],6B0K_C Crystal structure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A2H2	6.18e-40	14	460	14	511	N-acetylgalactosamine-6-O-sulfatase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_3333 PE=1 SV=1
Q32KJ6	3.67e-39	19	380	22	375	N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus OX=10116 GN=Galns PE=1 SV=1
P08842	5.47e-39	32	392	28	443	Steryl-sulfatase OS=Homo sapiens OX=9606 GN=STS PE=1 SV=2
P15589	4.66e-38	8	392	5	442	Steryl-sulfatase OS=Rattus norvegicus OX=10116 GN=Sts PE=1 SV=2
T2KM26	5.87e-38	18	467	19	468	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.015988	0.983773	0.000007	0.000009	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_00580.