CAZyme Information: MGYG000000138_00617

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_00617
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1261	MGYG000000138_2|CGC4	142091.23	6.0192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 292943; End: 296728 Strand: +

Full Sequence      

MNTRFVTFVLLLFVWLEGNSVWAQYLPKLYQVFSPDKKLVMAIQRHNDGLLTYTFAANRE
VLIKESSLGFKLESQETVPSSGWKIENVSDRQVRNEWRPLWGKRAVVKDHFNELVIDLLN
PAGQPERMQLIVRGYNDGFAFCYKIPEGEGECVNVQSELTAYNFAGDYTAWFYNGENHNI
GPEKLTETDGTRLPVMTVKAGDKHYMAIHEACLETGATLVLQSKGGESLFSVVSKPASLS
PGYTSAWRVVLYGTTPGALTDSHLLELLNPDPDPRYDFSWVKPGLAVWDWRINGAVWDGF
TYGMSYPSWVRMVDFAAEQGFKYLVLDANWYGPEFESDSDPVKGEKAQDVQRLLKYGKEK
GVGIWLYLNDVGGRKYPIEKTLKQYGDWGAAGVKYGFMSGTQEEKNQWTKKITELCAQNR
LLVDFHDGPVHPYGQMRTWPNAVTREYCHAQLDGHHVFEPKTFVTTVFVNMVAGPVDMNN
GMFDLRQGHTTRVDESQPVPSTLVSEAARTLIAFSGVTILPDIPEYYRKYPVLLNFLSAQ
KMPWRESRTLAGEIGEYIVMMRETDEAYLVGAATNESGRTIDLPLSFLEKGNYTVEVIED
GDDAHYLTNRESLKVTTRQLTNNDKLALKLAPGGGACLVIKKNPSMRVCEQATFPLVSPS
GKMNADIKVGGKDVEIDLFANSEKVVTAKTLQFSLDENILKGNWKVTNQKRESVDQTWQP
VYGERSVVPDRYNEIELTLQSDENRKEMVLCVRLYDEGLAFRYAFDKLDFWNRTVTDEKT
QFLFQQDCKTWVTGMAQGAYSETKLSALEGAADRPQVIRVDDNRFVAIGEAALVDYSRMK
LEKSETGFGVQSVLSGKVNLDLAGYRSPWRYVMVAGHPGKLVENNYFVLNLNEPNQIANT
SWIKPGQVIREVTLTTAGSMACIDFAAENNIAYVLFDAGWYGAEEDVKSDATTVTIDPAR
SKGPLDLPQVIEYANSKGVGILVYVNKKALHQQLDEILPLYKKWGIKGVKYGFVNVGDQY
ATAWLHQAVRKAAKYELMVDIHDEYRPTGYSRTYPNLLTQEGIRGDEESPSLDQAIYTLY
NRMICGAGDYTNCYFAERVTEKMGGRAAQLAKLVAIYSPWQFVYWYDRPEKSPRRAGGAG
AAESVIKTDAATRFYNSIPTVWDETRFLEGEMGKYAVVARRSGSDWYVGVLNAGEKKQIT
LPLDFLKNKKGYTATLYYQASEKKKDVVDIKKIKLDNRNEVTVGLTGNSGCVLHFSILNF
Q

Enzyme Prediction     

No EC number prediction in MGYG000000138_00617.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	651	1255	6.9e-152	0.9809825673534073
GH97	28	640	1.5e-143	0.9793977812995246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	4.90e-56	658	894	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.11e-53	900	1130	2	262	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	3.53e-52	34	270	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.87e-50	277	538	1	275	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	3.07e-34	544	641	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68310.1	4.08e-308	32	642	24	631
BBE16916.1	1.68e-301	16	642	12	638
QUT75478.1	1.06e-294	1	643	1	641
QUT49475.1	9.76e-292	259	663	1	405
QUT49474.1	2.26e-262	870	1261	6	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	2.85e-60	657	1217	19	614	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	1.80e-59	657	1217	5	600	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
3WFA_A	1.02e-52	700	1250	72	698	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.04e-52	700	1250	81	707	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	1.19e-52	700	1250	92	718	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	3.96e-60	651	1217	20	621	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	6.53e-52	700	1250	92	718	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	4.34e-49	49	651	57	632	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000190	0.999238	0.000149	0.000150	0.000132	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_00617.