CAZyme Information: MGYG000000138_01383

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_01383
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531	MGYG000000138_4|CGC10	60859.89	5.6612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 373169; End: 374764 Strand: +

Full Sequence      

MTRKSICLLFLVLLALPCFAASKYESKITSLEGEKWWGGAVGLGSKMPFEGDLRLFDLSV
ENLNNQNVPLLLSSEGRYIWSDKPFSFQVENGELRLYSDYEKMEPVLAGRTLKDAYMAAS
AKHFPPSGDLPDPLFFSMPQYNTWIELMYNQNQEDILKYADHVLENDFPVGVFMVDDNWQ
KYYGNFDFKPERFPDPKGMIDRLHRQGFKIMFWICPFVSPDSPEFRELQQKGFLIKKKGT
NEAAIIPWWNGYSACYDLSNPAAAEHLKQQLRGMQEKYGADGFKFDAGDIGHYNDPELEF
YDKSATSVDMCRYWAKIGLDFPFNEYRAGWKMGGEALVQRLGDKDYSWNAVGLLIPDMIA
AGLLGYAYACPDMIGGGQFASFLGVDQTKLDQELIVRSCQVHALMPMMQFSVAPWRILDE
KHLAICRDYARLHEKMGAYILEQAYHAAKTGEPIIRHMEYAFPHQGFVDCKDQFMLGDRY
LVAPVLTKEHTRKVMLPEGVWVDDTGKKFKGPKTIEVTAPLERLPWFEKVK

Enzyme Prediction     

No EC number prediction in MGYG000000138_01383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	142	528	1.5e-86	0.9110070257611241

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.51e-171	137	501	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	5.68e-60	151	525	40	433	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	5.78e-60	65	529	191	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06593	GH31_xylosidase_YicI	4.79e-34	141	432	11	304	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
cd06597	GH31_transferase_CtsY	2.96e-33	144	434	14	325	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50281.1	0.0	1	531	1	531
QRP90828.1	1.36e-268	1	530	23	549
AKA54123.1	1.74e-268	1	530	1	527
QCQ32141.1	1.74e-268	1	530	1	527
QCQ36424.1	2.46e-268	1	530	1	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	7.00e-33	141	501	269	635	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	7.08e-33	141	501	269	635	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	4.56e-28	141	501	269	635	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	8.08e-27	18	525	183	706	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7S_A	7.59e-23	129	530	289	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	3.30e-54	106	522	283	703	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	8.26e-53	106	522	282	705	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P31434	3.83e-32	141	501	269	635	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
P96793	2.50e-25	66	516	193	653	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
D2PPM7	2.27e-21	185	525	343	707	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000313	0.998947	0.000208	0.000169	0.000174	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_01383.