CAZyme Information: MGYG000000138_02055

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_02055
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	MGYG000000138_7|CGC4	83410.96	6.6874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 106522; End: 108798 Strand: -

Full Sequence      

MKLIYLLLALLLSVGPVKAKKVVREIYPYKDPTLSIEQRVDDLLKRMTVEEKVYQMCALR
LGEGDEIFRTSGEYTIDLIRKEFGAHGIGNVSCPTTDRFAEHSVKTINEIQRVAVEETRL
GIPVLVNDEALHGVKGKGATCYPQSIALSSTWNLSLMKEVADAIGRETHSRGITQVLSPT
LDLARDPRHGRVEETYGEDPGLAALFGVEFIKGVQRQGVICSPKHFIANFVAPGGREAGN
ISLSERELREIHLVPYEAAVKQAGVKSLMAAYNAIDGVPCHANHWLLTDVLRGDWGFTGF
TVSDWSGVNHTHGYHRIASSCEESAVLCSKAGLDVDLPRMRSYKLLIDAIKSGKIEESDI
DVNVRRILRVKFELGLFEDPYVEEKDAVRLQDAPEFRNLARKAARQSIILLKNENQVLPL
KYKKIAVVGPNADVLQLGGYSAAGVKGNTPLQGIKAAFKGISEILYAKGCGLTQKDFSGF
DEALAVAKQADVTVLVMGGCNGVTGGETQDRIDLDLMGVQEELIKRVSALGKPVVVVLVD
GRPVTMMDWIDEVDGVVMMFYAGEEGGNALGEVLAGMVNPSGKLTVTIPRYTGQLPMPLL
SRPHGRESSFAEFPSIKRSDPIIAKYNRYYPLFPFGYGLSYTSFKYSDLKLSKKEIQKGN
DIVVSVNVTNEGAVDGDEIVQLYLTDLYCRISQPQKKLQGFQRVSIPAGETRRVTFTLTG
KKMSFLNECLKEEIGDGEFEVFVGKNCMDGVSDKFVVK

Enzyme Prediction     

No EC number prediction in MGYG000000138_02055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	116	338	3.4e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.96e-176	34	744	29	751	beta-glucosidase BglX.
COG1472	BglX	8.19e-96	47	470	1	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.43e-93	83	743	37	777	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.21e-80	48	370	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	2.69e-69	408	641	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW11231.1	0.0	25	757	9	743
AOW11394.1	0.0	47	757	1	713
AOW11229.1	2.14e-269	35	755	8	728
ACK42995.1	6.26e-212	35	758	5	756
ACI20082.1	9.12e-209	88	758	97	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.39e-135	29	744	36	771	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	3.07e-132	35	758	9	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.69e-131	35	758	9	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	9.55e-128	29	749	7	747	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.34e-127	29	749	7	747	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.06e-140	107	744	50	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.37e-124	40	744	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	2.01e-123	6	758	4	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	9.90e-123	40	744	38	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	2.10e-98	119	749	34	659	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999190	0.000155	0.000141	0.000134	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_02055.