CAZyme Information: MGYG000000138_02230

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_02230
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000000138_8|CGC1	44498.4	6.7054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 43334; End: 44503 Strand: +

Full Sequence      

MKTTIKYICTGISLCACTCLVNNLPAQAETKNTATVSATETDWNRQSVMDVARRVADWQI
KDYPENKYAKSEPRGWVPAALYMGMFDWAELSGDNTYYDWLRKIFNRQSWQVANRMYHAD
DVCIAQTYIDFYNKEKNENMLKPTIARADWVLNNPSNGSMDLDYSKGSTIERWTWCDALF
MAPGVYTRLYTLTGNRKYMYFADGEFRATYNHLYDKDEDLFYRDSRYIGQKEANGKKVFW
GRGNGWVIGGLAEILKTLPAEDTEFRPFYLELYKEMSERLAGLQGKDGYWHASLLDPDSY
PSPETSATGFIVYGLAYGINQGYLPADKYLPVVKKGWKALTRAVETNGKLGWVQPVGADP
KKVTRDMTELYGTGAFLMAASEIYKLADK

Enzyme Prediction     

No EC number prediction in MGYG000000138_02230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	69	385	2.1e-88	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.25e-105	51	386	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.00e-50	80	387	41	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	3.68e-290	1	389	53	441
QUT74307.1	5.90e-162	43	386	23	366
ASM65072.1	2.39e-155	32	387	15	371
QUU06865.1	2.39e-155	32	387	15	371
QRP56352.1	2.39e-155	32	387	15	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	4.12e-78	73	386	50	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.62e-57	48	382	33	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.10e-49	122	382	102	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	9.19e-85	46	383	51	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	9.84e-78	73	388	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	2.77e-77	73	386	57	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	1.60e-10	122	353	76	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001054	0.654591	0.343135	0.000455	0.000412	0.000319

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_02230.