CAZyme Information: MGYG000000138_03163

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_03163
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	MGYG000000138_12|CGC2	86106.81	6.3446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 168786; End: 171077 Strand: +

Full Sequence      

MKKRLISVLVMLLLPLLVVARQRVIVDTDIDSDVDDAGTLAMLYTLHKQHKINLLGTIVT
SDDPFAVTCVSAFNAYYGMGDLPLGFLKGQSFLKNHSRYTRQISEEFPHDLPSWKDAETA
TNTYRKLLAGSPDHSVVILTIGHLSSLQRLLQSPADQYSHLNGKQLVEAKVKRWYCMGGL
FPEGKEANFSRPDPGSTVFCLANWTKEVVFCGWEIGERIITGDLALKAELNPKNPMYRAY
ELYNDFKGRASWDQVTAFLLADEASHYLELDNAGSCLLEADGSNRWIPGKKGNQFIVRFR
PEVNVKELAGKITDLMLGKNIPDYSYLPWVGKSVDFSHGPLAVSENKRFLVHADGTPFFY
MGDTAWELFHRLTEEEIDRYLENRREKGFNVIQAVILAELDGLNTPDRNGNRPLVNNDPA
QPDEAYFNWVDRIINKAAAKGLYMGLLPTWGDKVDKQWGIGPVIFNERNIAGYGRFLANR
YKDYPNIIWIIGGDRNGGDANMLVWNALANAIKSIDKNHLMTFHPYGRHTSSQWFHNADW
LDFNSSQTGHANCSFDIFENLIVGDYNRIPVKPCINMEPCYEDHPVRGDICTSTTWFDDT
NTRQALYWSLFSGAAGHTYGCHPIWQCMSPVYEPAGNVLNNWYDDLDLPGAGNMIHARRL
FEKYDFFSRRPAPEIILTKQLVIGDMAVAVQGKGYAFVYLPNGNPVDVCLETLPEATTLT
LQWYNPRTGQYTLIGEVSAKGNYRAKPISSGIGNDWILVMNSK

Enzyme Prediction     

No EC number prediction in MGYG000000138_03163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	339	758	5.6e-146	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	4.99e-155	346	664	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
cd02652	nuc_hydro_2	1.84e-33	37	288	14	271	NH_2: A subgroup of nucleoside hydrolases. This group contains eukaryotic and bacterial proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity.
pfam12904	Collagen_bind_2	5.45e-21	671	760	2	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).
pfam00150	Cellulase	5.03e-06	353	520	3	162	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	0.002	309	527	11	230	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD20980.1	1.97e-222	329	760	30	461
BBE19187.1	1.10e-182	329	763	23	455
BCI62058.1	1.30e-175	329	763	28	463
SNV48981.1	1.02e-161	327	761	23	455
AXC13913.1	4.25e-140	341	762	33	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	6.71e-86	325	760	9	444	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.91e-82	325	760	9	444	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	2.85e-80	325	760	22	460	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001298	0.997476	0.000548	0.000241	0.000205	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_03163.