CAZyme Information: MGYG000000138_03724

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_03724
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546		62410.76	7.2589

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 113712; End: 115352 Strand: -

Full Sequence      

MKKILLTAGFALFAWGSTCLAQSTYFSDSKEWLRKAEACKPELSYQTISPVKVVRSVQDT
KAFQGWRMEDAGQPDILFNGPFKKHPAITLDFGNHYTGYLTFSIKPSGLKAADAPVRLKF
TFAEVPGELNTPLEPYKGGLARSWVQDEIVTVMSVPHEMTIPRRLAGRYLKIELLGISGS
FDFVFDKLTFKAQTSVTNEAPALASTTDPLVRDIYEVGLNTLKECMQTVYEDGPKRDRRL
WIGDLYLEALANAHTFKNHELTKHCLYLLAAFANDEGLLHATLLEKPQPHPQYGTHTLDY
CLIYNVALLEYLKETGDRETANDLWPVVVRQIELALRQFSPEWIYDMDKKPQYWLVFDWK
DGYDRQASMQGLTIFALQHSYELAKMLGKEKEAGEWPTIAGKMKKAARQHFYDKKRGVMV
SGKDKQISYLSQVWMILSNTLDKKEGAKAMATVMSMPDACYPGCPYAYHYVIEALLQCGM
PQEARKLITDYWGSMVKRGADTFWEVYDPNNDYLSPYGFFVINSYCHAWSCTPIYFINKY
PEIFQK

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	87	540	3.7e-74	0.8551587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.36e-21	205	540	7	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3459	COG3459	3.88e-08	307	455	677	856	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
COG3408	GDB1	7.35e-08	256	427	299	479	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	4.63e-04	311	453	138	299	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47931.1	0.0	1	546	1	546
QUT21624.1	2.19e-304	18	546	15	542
QUT55846.1	2.19e-304	18	546	15	542
QCY57563.1	2.63e-304	18	546	20	547
ABR44139.1	2.63e-304	18	546	20	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	6.28e-125	32	540	39	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
3CIH_A	1.58e-24	214	540	314	635	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	3.82e-19	207	539	542	874	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000484	0.998442	0.000538	0.000191	0.000166	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000138_03724.