CAZyme Information: MGYG000000139_00062

Basic Information

• Species: Eubacterium_G sp000434315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp000434315
• CAZyme ID: MGYG000000139_00062
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	MGYG000000139_1|CGC2	65751.22	8.6431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000139	2758071	Isolate	United Kingdom	Europe

• Gene Location: Start: 63823; End: 65508 Strand: -

Full Sequence      

MKYTANAPQGFKYKLKRTVKKIVQPFRISEKDKGKLLYNKFLSMPVNDKFIFYEAFAGLG
ILDNPRAIFKYLLNQEDFKSYTHIWSVENPELAADNISEFSSLDNVIIVKRESEDYYKYL
ATSKYLINNSTFGYYFEKRNSQVYINTWHGVPTKYMGYEHTAERVENARGPARNFLLADY
LVSANQFMTEVMYKRAYKLDGLFQGKILELGHPRSDAIINPNTLDVHRKLNTAGIHTDKK
IILYAPTWKGTLYNNLDYNVEDFKKTVAKLSENIDTEHYRIYLRVHYFLYKILANDPELR
PMLIPFTIDTNELLSVVDVLISDYSSIFFDFLATKKPILFYVPDLEEYQSGRGLYVPVSR
LPGYVSSNINDISITLGNICTSELVNPIREKYLERYSKLHEDMSQWCIYNDDGNSCKRLV
DVVFRREPVSELEGNGVYSVINGLEAHKEKILICVNTNYNDMTFYENLRKKLESYEYRTT
DVTILTTSFTDTKYKVYFNNNIPKEVRVLVWYALPYVTKYNQKFFKREIKRSLGNVRFDE
VLMEGTLTEYWAEFGNAIKKL

Enzyme Prediction     

No EC number prediction in MGYG000000139_00062.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.15e-74	45	424	1	359	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.27e-54	44	427	22	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW70482.1	3.68e-106	38	539	41	542
BCD36658.1	3.68e-106	38	539	41	542
QMW70490.1	4.56e-97	46	424	34	402
BCD36650.1	4.56e-97	46	424	34	402
QMU10160.1	7.52e-95	11	560	9	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	3.77e-40	46	425	350	716	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	3.13e-39	46	425	350	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	7.72e-39	46	425	350	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	5.86e-44	44	421	27	390	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	1.97e-39	46	425	350	716	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	2.77e-37	12	427	338	746	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	4.73e-30	15	425	2	389	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q2G1C2	4.46e-16	139	426	241	513	Teichoic acid ribitol-phosphate polymerase TarK OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000139_00062.