CAZyme Information: MGYG000000139_01379

Basic Information

• Species: Eubacterium_G sp000434315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp000434315
• CAZyme ID: MGYG000000139_01379
• CAZy Family: GH1
• CAZyme Description: 1,4-beta-D-glucan glucohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000000139_3|CGC2	54758.78	4.9818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000139	2758071	Isolate	United Kingdom	Europe

• Gene Location: Start: 46705; End: 48114 Strand: -

Full Sequence      

MDRKFLWGSATAAYQCEGGWKEGGKGMSNWDTFCHSEKNNINPVTGDVACDHYHRYEEDI
KMIADGNQNAYRFSIAWTRIIPDGVGKISREGIDFYNRLIDTCKKYNVEPLVTLYHYDLP
QSLFENGGWENRATVDAYEEYVKVCFKEFGDKVNYWATINEPNYETLCCYGFGNYPPNVK
NLERRWKAMYHLMLASARAVKAYKNMGYKGMIGLVSDSYPIEILKDNEEYRKAKKLANIF
FNTSVNDTCIKGYYPDEYIEHLTELGYDLSYMKEEDKEIFKAGTVDYLGVNAYCRFLVKP
CTGRETVMEVNNTGDSSKNEEMEIKDWCALDDDPNTKKTPWGTEIYPKSVYDMLMEFKEL
YPDTPIIITENGLGEYDIVEGEKIHDQYRINFLQGYVDWIKKAIVEGCDCRGYFVWSTMD
VYSWINGYKKRYGLVYIDFDDNCKRIPKDSYHWYKEFIKEKGGSYNGKI

Enzyme Prediction     

No EC number prediction in MGYG000000139_01379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	462	3.3e-155	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	7.93e-163	5	462	8	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	5.25e-159	5	462	9	452	Glycosyl hydrolase family 1.
TIGR03356	BGL	1.89e-155	5	454	4	426	beta-galactosidase.
PRK13511	PRK13511	3.16e-137	5	461	9	466	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	4.27e-88	5	459	32	481	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70230.1	2.20e-232	1	458	1	458
AEE90266.1	2.18e-191	2	458	4	461
CDI40268.1	2.18e-191	2	458	4	461
QJA01910.1	8.23e-179	1	460	1	462
AIS09340.1	3.84e-176	4	458	3	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	4.64e-133	3	462	13	449	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6ZIV_AAA	3.43e-115	5	462	19	454	ChainAAA, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_BBB Chain BBB, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_CCC Chain CCC, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_DDD Chain DDD, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_EEE Chain EEE, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_FFF Chain FFF, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_GGG Chain GGG, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_HHH Chain HHH, Beta-glucosidase [Alicyclobacillus tengchongensis]
5YHS_A	9.12e-115	5	462	7	466	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)],5YHS_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, apo form [Bacillus sp. (in: Bacteria)]
5YIF_A	7.27e-114	5	462	7	466	Pyruvylatedbeta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)],5YIF_B Pyruvylated beta-D-galactosidase from Bacillus sp. HMA207, E163A mutant pyruvylated beta-D-galactose complex [Bacillus sp. (in: Bacteria)]
4PTV_A	2.84e-113	5	462	11	447	Halothermothrixorenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTV_B Halothermothrix orenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTW_A Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTW_B Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTX_A Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168],4PTX_B Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10482	1.95e-108	5	460	9	453	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
B9K7M5	1.56e-107	5	462	8	441	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q97EZ2	2.20e-106	5	461	8	464	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1
P26208	5.61e-103	3	462	8	447	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q08638	1.05e-102	5	462	10	443	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000139_01379.