CAZyme Information: MGYG000000139_02321

Basic Information

• Species: Eubacterium_G sp000434315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp000434315
• CAZyme ID: MGYG000000139_02321
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	MGYG000000139_7|CGC2	96938.84	8.2066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000139	2758071	Isolate	United Kingdom	Europe

• Gene Location: Start: 56039; End: 58705 Strand: +

Full Sequence      

MFKKGIAFITAVALVTSGIVFTPSNADASVNSNQGSNSWKLVWSDEFNQTVGQAPDTSVW
NYDIGHGSNGWGNNELQRYTDSTNNVYIADLSSDSGSSDGRALAIKAQKEGSEYTSGRIQ
TQNKQYCKFGRIETKLRVENGSQSGVWPAFWMLGQNYNASGNNWNGAYGASPWPSCGEID
IMEHRNAETQVIGTLHWNPSTTNYEHVYAGSETTKSFGAIDTIENWHTYAIEWYEDCMKW
YVDGICYQTMNISSEQMDEFQRDHFIILNLALGSNSSPFTLNQTVSANFTNATMYVDYVR
VFQGNNASFSIKNKKEGITQPETTTNRFSSMTSINNDGNMHNIGQWNYLFAGSWTGTSGY
YKGGTDLNDLEVYIGSNNNTSEEWGAQLKTNALSLNAGKTYNYSISLESDKAGAEVLLKN
DTDGIELQRKTLTNGKNVFAGTITSEKGNAELIFALGKVAAGTTLKVTDFTISDSSGEIT
TKVPETTKVSETTTKIAETTTASGNKPETPFGLVVNCPSDNTISVVWGNVVGNLYNIYID
GVKVKEAVGCAEYRFEGYSAGSHTVEVCTIKDGIESDKISGTVNVTGKGETTKAPETTKV
SETTTKIAETTTASGNKPETPFGLVVNCPSDNTISVVWGNVVGNLYNIYIDGVKVKEAVG
CAEYRFEGYSAGSHTVEVCTIKDGIESDKISGTVNVTGKGEITTKAPETTTKIAETTTKK
PEQTTNKQEQTTKAPETTTKKQEQTTKAPETTTKKQEQTTKAPETTQPSKVSDTTKADNT
NQSTIQQTEHKCIVSVGNTKVIKKKSLKKKIKLTVKKAANAKGYVVQYSTSKKFTKKTTK
TINVAKTTVVLKKLKSNKKYYIRVRGYAVSNDEKVYGKWSAKISAKSK

Enzyme Prediction     

No EC number prediction in MGYG000000139_02321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	43	302	8.1e-66	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.02e-71	43	302	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	8.68e-53	39	303	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	1.10e-27	45	302	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	9.42e-24	41	303	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
COG2273	BglS	3.05e-23	7	325	18	285	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR99686.1	1.46e-53	1	308	1	269
AQS13672.1	1.46e-53	1	308	1	269
AQR89784.1	1.46e-53	1	308	1	269
AQS09416.1	1.46e-53	1	308	1	269
AGX42499.1	1.46e-53	1	308	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JH5_A	1.33e-47	39	303	4	232	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	8.70e-47	39	303	4	232	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
4CRQ_A	6.23e-44	39	303	3	231	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
2HYK_A	4.36e-41	41	303	9	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3ATG_A	6.08e-39	41	318	5	254	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	1.99e-37	39	308	25	258	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P23903	8.70e-33	41	303	425	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	1.14e-32	39	303	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	6.48e-30	39	305	20	270	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q9ZG90	1.45e-19	39	443	56	402	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999133	0.000147	0.000186	0.000153	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000139_02321.