CAZyme Information: MGYG000000140_00058

Basic Information

• Species: UMGS1375 sp900066615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375; UMGS1375 sp900066615
• CAZyme ID: MGYG000000140_00058
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
987		109716.16	7.18

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000140	3539979	Isolate	United Kingdom	Europe

• Gene Location: Start: 58715; End: 61678 Strand: +

Full Sequence      

MEKKKKKWLSLFLAVILAFAGLPVSLMAAGNAKSQTQETTKILPSQTSGEINCFSYESFS
GKSWTYNDDEAYIDLGSSNEKAEECFYRVTFKGNAIEVFANKSHNHGKVKYRVDDGAETL
VDLYESSRTTPQSVYKAENLTEGEHTLYAVTQKERSGSAVVNQVAYVQVTHSPYIAKDFK
LEDQGISLSVGQSYAISYSYTPSYATLNDMSYITSDKNIVSVSAQGTVTAKKSGTAVITA
SSQKAGISRTMEVEVREQGSVLGGNVTDHNTQYTQKRFAEVSVKKNRSETLTAWKNDRAV
SELVLSAIGGDFTNVAIQASDLTDGKKKIAAENVTATFIRSTKAYVYGYIYGNDVPAATE
ENRAEASDILWQSTPIDIKADTLQPVWVEFAIPKTAKSGIYKTQLTVTADQLDKPLVFEY
EVRVQNAELPDNYRDTFDIELWQYPYTSAEYYNVEPFSDEHLEIMKSSMELYKKAGGHAI
TASVIEDAWDGQTYSANDVHYPSMIKWIKNGDSFTYDYTDFDKWISFNKSLGIGDKIVLY
SVAPWHNSFTYWENGKLVKEGFSVGSTRYTTLWTDFLTDLAAHLTEKGWFDDSYIGIDER
GFSGTAFDLIESVKNKDGKSLKTAGAMDSFVEKKELAMRVTDLNVGDTAAAAHPADFEQL
VNDREAKGLRTTLYSCTGHRPGNFSLSAPVESYWSIVNAGKSGTAGFLRWAYDAWVEDPL
DDTTHSKFEPGDCFLIYPDEKTAQNPISRSSVRLERMAEGVRDINKLAVIKKEAPQLEDQ
IQKLYAGISTTAQGGHPAFLTDAQIATLSAEMDTFQAGIASLTDQYIKLTGRTEESETEA
ESETKKETESETKPTESETAATEKPDPKPQPDTKESETKQQVPSTETPAKARPAKVRGLS
IKAVSKGKLLLKWKKVKNADGYVVYRADKKKGKYKKVKVLNGAKKISFTNKKLKKKKTYY
YKVCAYHKVGKKKVYGSCSAVKSRKVK

Enzyme Prediction     

No EC number prediction in MGYG000000140_00058.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	263	793	1.1e-164	0.9479553903345725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	1.58e-22	703	771	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.
COG5492	YjdB	3.32e-05	187	308	192	305	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam02368	Big_2	1.83e-04	187	253	11	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBA55846.1	1.77e-285	38	829	29	824
QTQ18982.1	5.94e-285	38	829	50	845
BAQ98792.1	6.68e-285	35	829	26	824
ADO53743.1	1.11e-284	38	829	50	845
VEG17315.1	1.13e-284	35	829	47	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FQE_A	1.21e-102	247	833	15	609	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	1.72e-101	247	833	15	609	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5L7V_A	1.59e-78	287	773	50	519	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	2.30e-78	287	773	65	534	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000687	0.998441	0.000303	0.000188	0.000168	0.000168

TMHMM  Annotations     

start	end
7	29