CAZyme Information: MGYG000000140_00109

Basic Information

• Species: UMGS1375 sp900066615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375; UMGS1375 sp900066615
• CAZyme ID: MGYG000000140_00109
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000000140_1|CGC1	49240.19	7.782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000140	3539979	Isolate	United Kingdom	Europe

• Gene Location: Start: 134523; End: 135797 Strand: +

Full Sequence      

MVVAIMKGYTIFVIILMLLYTARHFYFTIVRLLGRQRLYYNDILTDRMKSISVLIPMHNE
EQVLSNVLDSLLKCEYDRDRLEIIPINDNSTDRTREMLDEYHRKYEFIRPLHRDCPDRGK
PVGLNDAMRLAKGEIIIVFDADYRPARNMLKQIALGFEDPQVGAVMGRVIPYNTNTNMLT
RLINLERSGGYQVDQQARYNLKTIPQYGGTVGGFRKDFLLETGGFNPKVLAEDTELTYRL
FTNGWKVVYANSAECYEESPESWNVRGRQIRRWSRGHNEVLFRYLIPTITTPYMGLFQKI
DGLFLLFIYSVPVFLLVGWVVSLGLFFLGEMQIFSGWWVILFLGIYNSLGNFAPFFEIGT
SLIIDGLPGEALLLSLMMFNFFFYMWNISLGFWDAVVDTVTGRGVKWDKTVRFTVQKTEK
EAEK

Enzyme Prediction     

No EC number prediction in MGYG000000140_00109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	51	276	1.2e-34	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.51e-59	53	233	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.03e-57	8	424	13	436	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	7.93e-44	50	276	2	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06439	CESA_like_1	6.38e-35	50	276	30	248	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
PRK11204	PRK11204	3.52e-33	1	365	5	364	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM08864.1	1.25e-236	1	414	1	414
QWT56260.1	3.24e-203	1	417	1	417
QNB48280.1	7.38e-199	17	413	1	397
QNP78262.1	6.73e-177	2	417	5	420
ADO44672.1	6.27e-169	5	413	7	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	7.57e-19	51	269	44	262	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	7.65e-19	51	269	45	263	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
7LBY_A	2.64e-11	50	276	274	500	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.32e-10	46	281	125	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.37e-10	46	281	137	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	3.85e-45	48	285	48	288	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8LIY0	1.03e-26	46	308	230	499	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
A2YHR9	1.99e-25	46	308	225	494	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC10 PE=3 SV=1
Q84Z01	1.99e-25	46	308	225	494	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC10 PE=3 SV=1
Q9ZQB9	2.03e-25	51	308	243	507	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995114	0.004741	0.000084	0.000014	0.000011	0.000071

TMHMM  Annotations     

start	end
5	27
280	297
307	329
334	356
371	393