CAZyme Information: MGYG000000140_01493

Basic Information

• Species: UMGS1375 sp900066615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375; UMGS1375 sp900066615
• CAZyme ID: MGYG000000140_01493
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
897	MGYG000000140_5|CGC2	102927.91	5.6419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000140	3539979	Isolate	United Kingdom	Europe

• Gene Location: Start: 140285; End: 142978 Strand: +

Full Sequence      

MKKRTEAVDIIIPVYNGYDDLQLCMPSVLKHTDLTKHRLILINDCSPDERIAPYLDSFAG
EHILVLHNEKNMGFSANVNKGMAQSEDRDVLLLNSDTIVTAGWLDKIIACAYREESIGTV
TPLSNSATLCSVPVMCQDNPMPENVTVDEYAGLIETCSLRRYPRITVAVGFCMYIKRSVI
DDIGVFDAETFGRGYGEENDFCNRAEQAGYHHVMCDDTFVYHKGTASFDTEEKKKLLEEH
EAILNDRYAAQMRMNHLYCMENPDQEIRDNINMYTKLHNGKQNILYLLHLDFQEGAFNNI
GGTQIHVKELTMALRDEYNVFVAARDKEYLRLTIYTDKDVVSLKFEIGEAPKFPVFRDEK
MRKIYEQILLAFDIDMVHIQHSQDLSLELYFAAERFGIPVIATIHDFYYACPTIILLDNE
NQFCQKEDVKLSFEERQKRCRECLRQKKDIASQVDYLRIWRRENKKALSICRKLIFPSES
ARDILLEYFPSLKEKCMVIEHGEDKLERDIIHVPSPEKHQKSEHLHVKLDRVPGSDQGLN
DIKGWAYLEGVPNEETKIYVEFTDSKGKKDCFLANKVPRPDIVDAFGATEALMCGLDLRI
STRKLADGPVKIRVYVKHDGVFYTDNQSTKGEYHHRFGKRGRLNVAFLGGMVPQKGSLMA
KELIPMDKGGINWFVLGAIGDKNILEISQENCFFSSTYKKEELPQLLEDNEIDIICILPI
WPETFSYTVSEAWLNGIPIVATDIGAVGERIRKTGGGWLVKPDAKPDEIMQLLHHIIDHP
EEYQAKKEIVDDMEMKTVEQMCEEYRSFYRELLEFTEKELPEDKIDRDFIFQGLALGDPS
IGGSGSIAAMNRLKNENAALKASIEVTKGTISYKMARKISDAKIPFKEQMKRFFHRK

Enzyme Prediction     

No EC number prediction in MGYG000000140_01493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	180	4e-18	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	3.48e-27	10	259	7	254	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	8.50e-26	10	224	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd03823	GT4_ExpE7-like	1.37e-23	298	810	12	356	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
pfam00535	Glycos_transf_2	1.40e-16	9	180	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd03801	GT4_PimA-like	5.22e-16	283	810	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK78211.1	1.30e-181	6	809	2	761
QMW89727.1	1.66e-181	6	809	10	769
AIQ20837.1	5.81e-149	9	875	8	741
QYK69601.1	2.09e-148	4	809	2	687
ALA44139.1	4.02e-148	4	809	2	687

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000140_01493.