CAZyme Information: MGYG000000140_02985

Basic Information

• Species: UMGS1375 sp900066615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375; UMGS1375 sp900066615
• CAZyme ID: MGYG000000140_02985
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959		105956.26	6.8225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000140	3539979	Isolate	United Kingdom	Europe

• Gene Location: Start: 30656; End: 33535 Strand: +

Full Sequence      

MKNAAKTPGKLLAGLCLILFFCLMPIRSYAAEQQLSEITKLYVTGIYGSEILPQQKVNWQ
YADKGYYLCMPSGADLSNVQLHFTESSDGSENADSYVMIGGQKINCGDSANLSGTSKLQI
SLAGGKSVTVNIVKSAEIPAMFIQTASGTLDKVHASKDNKEKGTMALVKADRSVDFDGNL
KQIKGRGNSTWGFAKKPYNIKLENSSDLLGMGKGKGWCLLANYADRSLLRNRIVYNLAEE
TGIPFTMDSRNIDLYINGDYMGSYLITEKIEIGKTRVNITDLEDATSKANNNADLETYEQ
KGTNDYKAGTQKWVDIPNDPEDITGGYLLELELGERYKDETSGFVTTGGQAVTMKCPECV
SENQIKYISEFYQNMENALYSKDGYTTDSKGERHALSDYIDIESLARMYLLQEFSMNLDS
GITSFYLYKDSDLTGDGKLHAAPVWDFDVALGNYTSRNGTDFTDPTQWWAKISRMYDNSS
KYNVMAQAVQHEEVWNKVKELWQSEFMPAIKYILGESTAYTATKIKTLDAYKAEVSASAA
MNFIQWRDLMENPWNHSSESFVNTGLTYDDNIEYLRNFMTKRCDFLNRNLGGESTGTDPD
TSQKVTVIEDDTRFYAAKNILNSSGDVRAEDTSDEGGGENLGYCNQGSLTEYKINVTTAG
TYNVTARVASNDGTGAFSIYVDNQKIATYRAVNTGGWQVWTTTDAQEITLEAGEHSFAIY
FEESGMNLNWLQFTRETGTDPKPDPKPDPDPDPTPTPTPDPDPTPDPNPTPTPTPDPTPT
PDQTPNPTPSPKPDSSKDQNTVTLTKGSICQDAKGILKYRITKMAAKNGTAEVIGIQKKS
GKVTIPSTITVQGITFKVTAIAEKAFRNDKNLKSVVIGSNVKKIGKQAFEKCRKLSSVTF
KGKKAPTIGKAAFKGIKKKTSVQVTGSMKKSQVKRLQKRMKTAAPSVKITYKKKITVRF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	616	735	1.4e-27	0.8695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	3.60e-35	624	734	33	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam08757	CotH	5.49e-30	183	586	1	318	CotH kinase protein. Members of this family include the spore coat protein H (cotH). This protein is an atypical protein kinase that phosphorylates CotB and CotG.
smart00606	CBD_IV	3.40e-21	622	733	14	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	5.64e-19	622	735	6	125	Carbohydrate binding module (family 6).
pfam18099	DUF5010_C	2.22e-12	624	731	2	110	DUF5010 C-terminal domain. This domain is found at the end of a family of putative glycosyl hydrolases pfam16402. This domain is likely to function as a carbohydrate binding domain due to its similarity with pfam03422.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUH93331.1	4.53e-53	124	588	238	697
QRR03748.1	1.66e-43	128	593	15	421
BCI64517.1	4.81e-41	126	586	21	416
AEY66151.1	7.68e-35	137	588	43	427
ASZ14583.1	3.27e-21	590	743	269	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UXZ_A	1.72e-14	627	735	17	129	Carbohydratebinding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A [Cellvibrio mixtus],1UXZ_B Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A [Cellvibrio mixtus],1UY0_A Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with glc-1,3-glc-1,4-glc-1,3-glc [Cellvibrio mixtus],1UY0_B Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with glc-1,3-glc-1,4-glc-1,3-glc [Cellvibrio mixtus],1UYX_A Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with cellobiose [Cellvibrio mixtus],1UYX_B Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with cellobiose [Cellvibrio mixtus],1UYY_A Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with cellotriose [Cellvibrio mixtus],1UYY_B Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with cellotriose [Cellvibrio mixtus],1UYZ_A Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with xylotetraose [Cellvibrio mixtus],1UYZ_B Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with xylotetraose [Cellvibrio mixtus],1UZ0_A Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with Glc-4Glc-3Glc-4Glc [Cellvibrio mixtus]
5G56_A	1.13e-12	627	741	373	487	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
2Y8K_A	3.56e-12	627	734	375	481	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5LA0_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20],5LA1_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20]
5LA2_A	3.56e-12	627	734	375	481	ChainA, Carbohydrate binding family 6 [Acetivibrio thermocellus],5LA2_B Chain B, Carbohydrate binding family 6 [Acetivibrio thermocellus]
1W9S_A	1.34e-08	627	733	26	138	ChainA, Bh0236 Protein [Halalkalibacterium halodurans],1W9S_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9W_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	5.23e-12	613	735	411	534	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000535	0.998657	0.000220	0.000214	0.000186	0.000169

TMHMM  Annotations     

start	end
12	31